BLASTX nr result
ID: Salvia21_contig00017693
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Salvia21_contig00017693 (319 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002284018.2| PREDICTED: probable glycosyltransferase At5g... 101 7e-20 emb|CBI30213.3| unnamed protein product [Vitis vinifera] 101 7e-20 ref|XP_002528630.1| catalytic, putative [Ricinus communis] gi|22... 97 1e-18 ref|XP_003521429.1| PREDICTED: probable glycosyltransferase At5g... 96 3e-18 ref|XP_003553575.1| PREDICTED: probable glycosyltransferase At5g... 94 9e-18 >ref|XP_002284018.2| PREDICTED: probable glycosyltransferase At5g03795 [Vitis vinifera] Length = 546 Score = 101 bits (251), Expect = 7e-20 Identities = 43/63 (68%), Positives = 53/63 (84%) Frame = -1 Query: 316 VKDIPNLKNILKAIPPDRYVEMQRNGVKVRRHFEVNFPPKRYDVFHMILHSVWLRRINVQ 137 V++IPNLK IL I P +Y+ MQR G++ RRHFEVN PPKRYDVFHMILHS+WLRR+N + Sbjct: 479 VREIPNLKRILMDISPRQYIRMQRRGIQARRHFEVNSPPKRYDVFHMILHSLWLRRLNFR 538 Query: 136 LHH 128 +HH Sbjct: 539 VHH 541 >emb|CBI30213.3| unnamed protein product [Vitis vinifera] Length = 337 Score = 101 bits (251), Expect = 7e-20 Identities = 43/63 (68%), Positives = 53/63 (84%) Frame = -1 Query: 316 VKDIPNLKNILKAIPPDRYVEMQRNGVKVRRHFEVNFPPKRYDVFHMILHSVWLRRINVQ 137 V++IPNLK IL I P +Y+ MQR G++ RRHFEVN PPKRYDVFHMILHS+WLRR+N + Sbjct: 270 VREIPNLKRILMDISPRQYIRMQRRGIQARRHFEVNSPPKRYDVFHMILHSLWLRRLNFR 329 Query: 136 LHH 128 +HH Sbjct: 330 VHH 332 >ref|XP_002528630.1| catalytic, putative [Ricinus communis] gi|223531919|gb|EEF33733.1| catalytic, putative [Ricinus communis] Length = 574 Score = 97.4 bits (241), Expect = 1e-18 Identities = 43/62 (69%), Positives = 52/62 (83%) Frame = -1 Query: 316 VKDIPNLKNILKAIPPDRYVEMQRNGVKVRRHFEVNFPPKRYDVFHMILHSVWLRRINVQ 137 V DIPNLK IL +I +Y+ MQR ++VRRHFEVN PPKRYDVFHMILHS+WLRR+NV+ Sbjct: 505 VSDIPNLKRILTSISSRQYIRMQRRVLQVRRHFEVNSPPKRYDVFHMILHSIWLRRLNVK 564 Query: 136 LH 131 +H Sbjct: 565 IH 566 >ref|XP_003521429.1| PREDICTED: probable glycosyltransferase At5g03795-like [Glycine max] Length = 534 Score = 95.9 bits (237), Expect = 3e-18 Identities = 44/63 (69%), Positives = 50/63 (79%) Frame = -1 Query: 316 VKDIPNLKNILKAIPPDRYVEMQRNGVKVRRHFEVNFPPKRYDVFHMILHSVWLRRINVQ 137 VKDIP LK IL +I P Y+ MQR VRRHFEV+ PPKRYDVFHMILHSVWLRR+N + Sbjct: 470 VKDIPRLKEILLSISPRHYIRMQRRVGLVRRHFEVHSPPKRYDVFHMILHSVWLRRLNFR 529 Query: 136 LHH 128 +HH Sbjct: 530 VHH 532 >ref|XP_003553575.1| PREDICTED: probable glycosyltransferase At5g03795-like [Glycine max] Length = 537 Score = 94.4 bits (233), Expect = 9e-18 Identities = 43/62 (69%), Positives = 51/62 (82%) Frame = -1 Query: 316 VKDIPNLKNILKAIPPDRYVEMQRNGVKVRRHFEVNFPPKRYDVFHMILHSVWLRRINVQ 137 VKDIP LK IL +I P +Y+ MQR +VRRHFEV+ PPKRYDVFHMILHSVWLRR+N + Sbjct: 473 VKDIPRLKEILLSISPRQYIRMQRRVGQVRRHFEVHSPPKRYDVFHMILHSVWLRRLNFR 532 Query: 136 LH 131 +H Sbjct: 533 VH 534