BLASTX nr result
ID: Salvia21_contig00017472
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Salvia21_contig00017472 (231 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002883375.1| predicted protein [Arabidopsis lyrata subsp.... 69 3e-10 ref|XP_003610751.1| hypothetical protein MTR_5g006600 [Medicago ... 69 5e-10 pdb|1VK5|A Chain A, X-Ray Structure Of Gene Product From Arabido... 68 9e-10 ref|NP_188907.2| RNA-directed DNA methylation 1 protein [Arabido... 68 9e-10 gb|AAP21198.1| At3g22680 [Arabidopsis thaliana] 68 9e-10 >ref|XP_002883375.1| predicted protein [Arabidopsis lyrata subsp. lyrata] gi|297329215|gb|EFH59634.1| predicted protein [Arabidopsis lyrata subsp. lyrata] Length = 167 Score = 69.3 bits (168), Expect = 3e-10 Identities = 31/54 (57%), Positives = 39/54 (72%) Frame = -3 Query: 163 PNDEPALELSAEAWLFRRAASYQEYMKSIPIPTNRGAVIPYTSWTGLGASMKQM 2 P D +++ E L RRA YQEYMK +PIPTNRG++IP+TSW GL SMKQ+ Sbjct: 30 PLDNSHRDVADEGSLLRRAEMYQEYMKQVPIPTNRGSLIPFTSWVGLSISMKQL 83 >ref|XP_003610751.1| hypothetical protein MTR_5g006600 [Medicago truncatula] gi|355512086|gb|AES93709.1| hypothetical protein MTR_5g006600 [Medicago truncatula] Length = 369 Score = 68.6 bits (166), Expect = 5e-10 Identities = 29/56 (51%), Positives = 44/56 (78%) Frame = -3 Query: 169 QKPNDEPALELSAEAWLFRRAASYQEYMKSIPIPTNRGAVIPYTSWTGLGASMKQM 2 Q P P++++++ L RRAA YQ+YM+ IPIP++RG+VIP+TSW GLG S+K++ Sbjct: 230 QSPISIPSIDINSSDVLIRRAAMYQDYMEQIPIPSSRGSVIPFTSWMGLGQSIKKL 285 >pdb|1VK5|A Chain A, X-Ray Structure Of Gene Product From Arabidopsis Thaliana At3g22680 gi|150261463|pdb|2Q3T|A Chain A, Ensemble Refinement Of The Protein Crystal Structure Of Gene Product From Arabidopsis Thaliana At3g22680 Length = 157 Score = 67.8 bits (164), Expect = 9e-10 Identities = 30/54 (55%), Positives = 39/54 (72%) Frame = -3 Query: 163 PNDEPALELSAEAWLFRRAASYQEYMKSIPIPTNRGAVIPYTSWTGLGASMKQM 2 P D +++ E L RRA YQ+YMK +PIPTNRG++IP+TSW GL SMKQ+ Sbjct: 24 PLDTSHRDVADEGSLLRRAEMYQDYMKQVPIPTNRGSLIPFTSWVGLSISMKQL 77 >ref|NP_188907.2| RNA-directed DNA methylation 1 protein [Arabidopsis thaliana] gi|73921107|sp|Q9LUJ3.1|RDM1_ARATH RecName: Full=Protein RDM1; AltName: Full=Protein RNA-directed DNA methylation 1 gi|9279686|dbj|BAB01243.1| unnamed protein product [Arabidopsis thaliana] gi|332643143|gb|AEE76664.1| RNA-directed DNA methylation 1 protein [Arabidopsis thaliana] Length = 163 Score = 67.8 bits (164), Expect = 9e-10 Identities = 30/54 (55%), Positives = 39/54 (72%) Frame = -3 Query: 163 PNDEPALELSAEAWLFRRAASYQEYMKSIPIPTNRGAVIPYTSWTGLGASMKQM 2 P D +++ E L RRA YQ+YMK +PIPTNRG++IP+TSW GL SMKQ+ Sbjct: 30 PLDTSHRDVADEGSLLRRAEMYQDYMKQVPIPTNRGSLIPFTSWVGLSISMKQL 83 >gb|AAP21198.1| At3g22680 [Arabidopsis thaliana] Length = 121 Score = 67.8 bits (164), Expect = 9e-10 Identities = 30/54 (55%), Positives = 39/54 (72%) Frame = -3 Query: 163 PNDEPALELSAEAWLFRRAASYQEYMKSIPIPTNRGAVIPYTSWTGLGASMKQM 2 P D +++ E L RRA YQ+YMK +PIPTNRG++IP+TSW GL SMKQ+ Sbjct: 30 PLDTSHRDVADEGSLLRRAEMYQDYMKQVPIPTNRGSLIPFTSWVGLSISMKQL 83