BLASTX nr result
ID: Salvia21_contig00017302
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Salvia21_contig00017302 (211 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003528886.1| PREDICTED: arginine/serine-rich-splicing fac... 72 6e-11 ref|XP_003521329.1| PREDICTED: arginine/serine-rich-splicing fac... 72 6e-11 gb|ACU23673.1| unknown [Glycine max] 72 6e-11 gb|AFK44835.1| unknown [Medicago truncatula] 71 1e-10 gb|ACJ84209.1| unknown [Medicago truncatula] 71 1e-10 >ref|XP_003528886.1| PREDICTED: arginine/serine-rich-splicing factor RSP41-like [Glycine max] Length = 253 Score = 71.6 bits (174), Expect = 6e-11 Identities = 31/35 (88%), Positives = 35/35 (100%) Frame = +3 Query: 105 MKPVFCGNLEFDARQSDIERLFRKYGRVDRVDMKS 209 MKPVFCGNL+FDARQSD+ERLFR+YG+VDRVDMKS Sbjct: 1 MKPVFCGNLDFDARQSDVERLFRRYGKVDRVDMKS 35 >ref|XP_003521329.1| PREDICTED: arginine/serine-rich-splicing factor RSP41-like [Glycine max] Length = 252 Score = 71.6 bits (174), Expect = 6e-11 Identities = 31/35 (88%), Positives = 35/35 (100%) Frame = +3 Query: 105 MKPVFCGNLEFDARQSDIERLFRKYGRVDRVDMKS 209 MKPVFCGNL+FDARQSD+ERLFR+YG+VDRVDMKS Sbjct: 1 MKPVFCGNLDFDARQSDVERLFRRYGKVDRVDMKS 35 >gb|ACU23673.1| unknown [Glycine max] Length = 234 Score = 71.6 bits (174), Expect = 6e-11 Identities = 31/35 (88%), Positives = 35/35 (100%) Frame = +3 Query: 105 MKPVFCGNLEFDARQSDIERLFRKYGRVDRVDMKS 209 MKPVFCGNL+FDARQSD+ERLFR+YG+VDRVDMKS Sbjct: 1 MKPVFCGNLDFDARQSDVERLFRRYGKVDRVDMKS 35 >gb|AFK44835.1| unknown [Medicago truncatula] Length = 294 Score = 70.9 bits (172), Expect = 1e-10 Identities = 29/35 (82%), Positives = 35/35 (100%) Frame = +3 Query: 105 MKPVFCGNLEFDARQSDIERLFRKYGRVDRVDMKS 209 MKP+FCGNL+FDARQSD+ERLFRKYG++DRVD+KS Sbjct: 1 MKPIFCGNLDFDARQSDVERLFRKYGKIDRVDLKS 35 >gb|ACJ84209.1| unknown [Medicago truncatula] Length = 294 Score = 70.9 bits (172), Expect = 1e-10 Identities = 29/35 (82%), Positives = 35/35 (100%) Frame = +3 Query: 105 MKPVFCGNLEFDARQSDIERLFRKYGRVDRVDMKS 209 MKP+FCGNL+FDARQSD+ERLFRKYG++DRVD+KS Sbjct: 1 MKPIFCGNLDFDARQSDVERLFRKYGKIDRVDLKS 35