BLASTX nr result
ID: Salvia21_contig00017271
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Salvia21_contig00017271 (400 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002510751.1| conserved hypothetical protein [Ricinus comm... 55 8e-06 >ref|XP_002510751.1| conserved hypothetical protein [Ricinus communis] gi|223551452|gb|EEF52938.1| conserved hypothetical protein [Ricinus communis] Length = 210 Score = 54.7 bits (130), Expect = 8e-06 Identities = 35/97 (36%), Positives = 46/97 (47%) Frame = -1 Query: 400 RSRKSRISPVLVAEEDPQSTHQIKINSNSYVHAKNARKAXXXXXXXXXXXRKLXXXXXXX 221 R +K+RISPVL+ + H + S K +KA + Sbjct: 124 RRKKARISPVLLVNQSSSQRHLLNPTSGDAYPRKTFQKAKGEQPPVGMGFSR-------- 175 Query: 220 XXXXXXXXXXHKYSSRRAKLAVRSFRIRLTTINEGSV 110 H+Y+SRRAKLAVRSFR+RLTTI EG+V Sbjct: 176 ---SGSVRRLHRYTSRRAKLAVRSFRLRLTTIYEGTV 209