BLASTX nr result
ID: Salvia21_contig00017044
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Salvia21_contig00017044 (1694 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003556204.1| PREDICTED: dihydrolipoyllysine-residue acety... 58 9e-06 >ref|XP_003556204.1| PREDICTED: dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex, mitochondrial-like [Glycine max] Length = 465 Score = 57.8 bits (138), Expect = 9e-06 Identities = 28/34 (82%), Positives = 31/34 (91%) Frame = +1 Query: 58 PSSVELGSVVPFTTMQSAVSRNMVESLAMSTFRM 159 P+ VELGSVVPFTTMQSAVSRNM ESLA+ TFR+ Sbjct: 238 PAGVELGSVVPFTTMQSAVSRNMAESLAVPTFRV 271