BLASTX nr result
ID: Salvia21_contig00016996
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Salvia21_contig00016996 (568 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002516681.1| conserved hypothetical protein [Ricinus comm... 64 2e-08 ref|XP_003599457.1| CCP [Medicago truncatula] gi|355488505|gb|AE... 56 4e-06 >ref|XP_002516681.1| conserved hypothetical protein [Ricinus communis] gi|223544176|gb|EEF45700.1| conserved hypothetical protein [Ricinus communis] Length = 180 Score = 63.9 bits (154), Expect = 2e-08 Identities = 26/67 (38%), Positives = 39/67 (58%) Frame = -1 Query: 475 GWLHLWIESDSIYIVKILVNKSCNVPWRYIAAWRAILRILPEFHLQVTHIYREGNAVADI 296 GWLHLW+ESDSIY+V + K +V W AW L + + +V++++REGN D+ Sbjct: 108 GWLHLWLESDSIYVVHLFRTKGTSVLWELRLAWSRYLHFVQQMDFRVSYVFREGNKPTDM 167 Query: 295 MANDSRE 275 D + Sbjct: 168 FQIDDED 174 >ref|XP_003599457.1| CCP [Medicago truncatula] gi|355488505|gb|AES69708.1| CCP [Medicago truncatula] Length = 162 Score = 56.2 bits (134), Expect = 4e-06 Identities = 25/62 (40%), Positives = 37/62 (59%) Frame = -1 Query: 472 WLHLWIESDSIYIVKILVNKSCNVPWRYIAAWRAILRILPEFHLQVTHIYREGNAVADIM 293 WL W+E+DS+ +V + S VPW + W L++L + V+HIY+EGN AD + Sbjct: 19 WLSFWLETDSM-LVFLTFKSSKIVPWHLVNRWNNCLQLLSSMNFHVSHIYKEGNKCADSL 77 Query: 292 AN 287 AN Sbjct: 78 AN 79