BLASTX nr result
ID: Salvia21_contig00016963
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Salvia21_contig00016963 (292 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004144762.1| PREDICTED: uncharacterized protein LOC101206... 69 4e-10 ref|XP_004158725.1| PREDICTED: LOW QUALITY PROTEIN: uncharacteri... 68 7e-10 ref|XP_004168118.1| PREDICTED: uncharacterized protein LOC101225... 64 2e-08 ref|XP_004135581.1| PREDICTED: uncharacterized protein LOC101219... 64 2e-08 ref|XP_002512493.1| conserved hypothetical protein [Ricinus comm... 64 2e-08 >ref|XP_004144762.1| PREDICTED: uncharacterized protein LOC101206622 [Cucumis sativus] Length = 404 Score = 68.9 bits (167), Expect = 4e-10 Identities = 40/97 (41%), Positives = 48/97 (49%), Gaps = 27/97 (27%) Frame = +1 Query: 82 KRWIFLKEFLYRSKSEGRNEGHKFWGSLSFSPVN------------------KEKKMAPL 207 KRW+FLK+FLYRSKSEGR+ HKFW ++SFS K+K M P Sbjct: 257 KRWVFLKDFLYRSKSEGRSSNHKFWSNISFSSAKEKKPTASTSTSSSTSSSTKQKAMKPS 316 Query: 208 TSNAKAKEGK---KKAVNSK------RRAIPPSAHEL 291 K G+ KK K +R IPPS HEL Sbjct: 317 AQKVKGGSGQVPAKKPATGKPTNGVGKRRIPPSPHEL 353 >ref|XP_004158725.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized LOC101206622 [Cucumis sativus] Length = 404 Score = 68.2 bits (165), Expect = 7e-10 Identities = 40/97 (41%), Positives = 48/97 (49%), Gaps = 27/97 (27%) Frame = +1 Query: 82 KRWIFLKEFLYRSKSEGRNEGHKFWGSLSF------------------SPVNKEKKMAPL 207 KRW+FLK+FLYRSKSEGR+ HKFW ++SF S K+K M P Sbjct: 257 KRWVFLKDFLYRSKSEGRSSNHKFWSNISFLQQXREKPTASTSTSSSTSSSTKQKAMKPS 316 Query: 208 TSNAKAKEGK---KKAVNSK------RRAIPPSAHEL 291 K G+ KK K +R IPPS HEL Sbjct: 317 AQKVKGGSGQVPAKKPATGKPTNGVGKRRIPPSPHEL 353 >ref|XP_004168118.1| PREDICTED: uncharacterized protein LOC101225864 [Cucumis sativus] Length = 391 Score = 63.5 bits (153), Expect = 2e-08 Identities = 40/93 (43%), Positives = 52/93 (55%), Gaps = 24/93 (25%) Frame = +1 Query: 82 KRWIFLKEFLYRSKSEGRNEGHKFWGSLSFSPVNKEKKMAPLTSNAKAK----------E 231 KRW+FLK+FLYRSKSEGR+ + FW ++SF+PV ++K S AK K E Sbjct: 248 KRWVFLKDFLYRSKSEGRS-NNNFWSNISFTPVKEKKSGGTNQSIAKQKFINPLVGRSSE 306 Query: 232 GKKK--AVNSK------------RRAIPPSAHE 288 GKK AV +K +R +PPS HE Sbjct: 307 GKKAKGAVGAKKNGVGKPANGVGKRRVPPSPHE 339 >ref|XP_004135581.1| PREDICTED: uncharacterized protein LOC101219146 [Cucumis sativus] Length = 391 Score = 63.5 bits (153), Expect = 2e-08 Identities = 40/93 (43%), Positives = 52/93 (55%), Gaps = 24/93 (25%) Frame = +1 Query: 82 KRWIFLKEFLYRSKSEGRNEGHKFWGSLSFSPVNKEKKMAPLTSNAKAK----------E 231 KRW+FLK+FLYRSKSEGR+ + FW ++SF+PV ++K S AK K E Sbjct: 248 KRWVFLKDFLYRSKSEGRS-NNNFWSNISFTPVKEKKSGGTNQSIAKQKFINPLVGRSSE 306 Query: 232 GKKK--AVNSK------------RRAIPPSAHE 288 GKK AV +K +R +PPS HE Sbjct: 307 GKKAKGAVGAKKNGVGKPANGVGKRRVPPSPHE 339 >ref|XP_002512493.1| conserved hypothetical protein [Ricinus communis] gi|223548454|gb|EEF49945.1| conserved hypothetical protein [Ricinus communis] Length = 417 Score = 63.5 bits (153), Expect = 2e-08 Identities = 29/57 (50%), Positives = 40/57 (70%) Frame = +1 Query: 82 KRWIFLKEFLYRSKSEGRNEGHKFWGSLSFSPVNKEKKMAPLTSNAKAKEGKKKAVN 252 KRW+FLK+FLYRSKSEGR+ +KFW ++SFSP ++ K T++ +A K K N Sbjct: 276 KRWVFLKDFLYRSKSEGRS-NNKFWSNISFSPAKEKNKSMNTTTSVQAAPSKDKVSN 331