BLASTX nr result
ID: Salvia21_contig00016428
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Salvia21_contig00016428 (548 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AGG38123.1| BTB/POZ domain-containing protein [Dimocarpus lon... 74 2e-11 emb|CBI39826.3| unnamed protein product [Vitis vinifera] 74 2e-11 ref|XP_002276318.1| PREDICTED: BTB/POZ domain-containing protein... 74 2e-11 ref|XP_004139768.1| PREDICTED: BTB/POZ domain-containing protein... 73 3e-11 gb|AFK49561.1| unknown [Lotus japonicus] 73 3e-11 >gb|AGG38123.1| BTB/POZ domain-containing protein [Dimocarpus longan] Length = 328 Score = 73.6 bits (179), Expect = 2e-11 Identities = 34/35 (97%), Positives = 35/35 (100%) Frame = -2 Query: 106 MSDSAYRVETTSRLAQWRIENLASCTYRKSDPFKI 2 MSDSAYRVETTSRLAQWRI+NLASCTYRKSDPFKI Sbjct: 1 MSDSAYRVETTSRLAQWRIDNLASCTYRKSDPFKI 35 >emb|CBI39826.3| unnamed protein product [Vitis vinifera] Length = 283 Score = 73.6 bits (179), Expect = 2e-11 Identities = 34/35 (97%), Positives = 35/35 (100%) Frame = -2 Query: 106 MSDSAYRVETTSRLAQWRIENLASCTYRKSDPFKI 2 MSDSAYRVETTSRLAQWRI+NLASCTYRKSDPFKI Sbjct: 1 MSDSAYRVETTSRLAQWRIDNLASCTYRKSDPFKI 35 >ref|XP_002276318.1| PREDICTED: BTB/POZ domain-containing protein At1g55760 [Vitis vinifera] Length = 328 Score = 73.6 bits (179), Expect = 2e-11 Identities = 34/35 (97%), Positives = 35/35 (100%) Frame = -2 Query: 106 MSDSAYRVETTSRLAQWRIENLASCTYRKSDPFKI 2 MSDSAYRVETTSRLAQWRI+NLASCTYRKSDPFKI Sbjct: 1 MSDSAYRVETTSRLAQWRIDNLASCTYRKSDPFKI 35 >ref|XP_004139768.1| PREDICTED: BTB/POZ domain-containing protein At1g55760-like [Cucumis sativus] gi|449529700|ref|XP_004171836.1| PREDICTED: BTB/POZ domain-containing protein At1g55760-like [Cucumis sativus] Length = 327 Score = 73.2 bits (178), Expect = 3e-11 Identities = 34/35 (97%), Positives = 35/35 (100%) Frame = -2 Query: 106 MSDSAYRVETTSRLAQWRIENLASCTYRKSDPFKI 2 MS+SAYRVETTSRLAQWRIENLASCTYRKSDPFKI Sbjct: 1 MSESAYRVETTSRLAQWRIENLASCTYRKSDPFKI 35 >gb|AFK49561.1| unknown [Lotus japonicus] Length = 328 Score = 72.8 bits (177), Expect = 3e-11 Identities = 34/35 (97%), Positives = 34/35 (97%) Frame = -2 Query: 106 MSDSAYRVETTSRLAQWRIENLASCTYRKSDPFKI 2 MSDSAYRVETT RLAQWRIENLASCTYRKSDPFKI Sbjct: 1 MSDSAYRVETTPRLAQWRIENLASCTYRKSDPFKI 35