BLASTX nr result
ID: Salvia21_contig00016371
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Salvia21_contig00016371 (230 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002278069.1| PREDICTED: auxin-induced protein 15A [Vitis ... 57 1e-06 gb|AFK49405.1| unknown [Lotus japonicus] 57 2e-06 ref|XP_002880365.1| hypothetical protein ARALYDRAFT_900532 [Arab... 56 3e-06 ref|XP_002869126.1| auxin-responsive family protein [Arabidopsis... 56 4e-06 emb|CBI17634.3| unnamed protein product [Vitis vinifera] 56 4e-06 >ref|XP_002278069.1| PREDICTED: auxin-induced protein 15A [Vitis vinifera] Length = 91 Score = 57.4 bits (137), Expect = 1e-06 Identities = 23/31 (74%), Positives = 29/31 (93%) Frame = +1 Query: 136 DVPKGHLAVYVGEYDEKRRFVIPVSYLNHPS 228 DVP+GHLAVYVG+ + ++RFV+PVSYLNHPS Sbjct: 21 DVPRGHLAVYVGDIETRKRFVVPVSYLNHPS 51 >gb|AFK49405.1| unknown [Lotus japonicus] Length = 101 Score = 56.6 bits (135), Expect = 2e-06 Identities = 25/32 (78%), Positives = 30/32 (93%) Frame = +1 Query: 133 ADVPKGHLAVYVGEYDEKRRFVIPVSYLNHPS 228 +DVPKGHLAVYVGE +K+RFV+P+SYLNHPS Sbjct: 31 SDVPKGHLAVYVGEL-QKKRFVVPISYLNHPS 61 >ref|XP_002880365.1| hypothetical protein ARALYDRAFT_900532 [Arabidopsis lyrata subsp. lyrata] gi|297326204|gb|EFH56624.1| hypothetical protein ARALYDRAFT_900532 [Arabidopsis lyrata subsp. lyrata] Length = 98 Score = 56.2 bits (134), Expect = 3e-06 Identities = 23/31 (74%), Positives = 29/31 (93%) Frame = +1 Query: 136 DVPKGHLAVYVGEYDEKRRFVIPVSYLNHPS 228 D+PKGHLAVYVGE +KRRF++PV+YL+HPS Sbjct: 27 DIPKGHLAVYVGERMQKRRFMVPVTYLSHPS 57 >ref|XP_002869126.1| auxin-responsive family protein [Arabidopsis lyrata subsp. lyrata] gi|297314962|gb|EFH45385.1| auxin-responsive family protein [Arabidopsis lyrata subsp. lyrata] Length = 106 Score = 55.8 bits (133), Expect = 4e-06 Identities = 23/29 (79%), Positives = 27/29 (93%) Frame = +1 Query: 139 VPKGHLAVYVGEYDEKRRFVIPVSYLNHP 225 VPKGH+AVYVGE EK+RFV+P+SYLNHP Sbjct: 37 VPKGHVAVYVGEQMEKKRFVVPISYLNHP 65 >emb|CBI17634.3| unnamed protein product [Vitis vinifera] Length = 163 Score = 55.8 bits (133), Expect = 4e-06 Identities = 25/32 (78%), Positives = 29/32 (90%) Frame = +1 Query: 133 ADVPKGHLAVYVGEYDEKRRFVIPVSYLNHPS 228 ADVPKGHLAVYVG+ EKR +V+P+SYLNHPS Sbjct: 93 ADVPKGHLAVYVGDV-EKRHYVVPISYLNHPS 123