BLASTX nr result
ID: Salvia21_contig00016229
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Salvia21_contig00016229 (818 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002529764.1| kinase, putative [Ricinus communis] gi|22353... 83 8e-14 ref|XP_003550197.1| PREDICTED: probable receptor-like protein ki... 81 3e-13 ref|XP_003550196.1| PREDICTED: probable receptor-like protein ki... 81 3e-13 ref|XP_003550194.1| PREDICTED: probable receptor-like protein ki... 81 3e-13 ref|NP_001237957.1| stress-induced receptor-like kinase precurso... 81 3e-13 >ref|XP_002529764.1| kinase, putative [Ricinus communis] gi|223530762|gb|EEF32630.1| kinase, putative [Ricinus communis] Length = 646 Score = 82.8 bits (203), Expect = 8e-14 Identities = 37/59 (62%), Positives = 45/59 (76%) Frame = +1 Query: 640 CGIIPNISDPFRLKDDPKNCGDPKYELACENNVAFMYLNSQKYLVKAVNYGNSTIRLAD 816 CG I NIS PFRL+ DPKNCG+ +Y L+CENN A +YL + KY V+A+NY N TIRL D Sbjct: 35 CGNIHNISYPFRLETDPKNCGNHRYTLSCENNTAILYLYAGKYYVRAINYSNFTIRLVD 93 >ref|XP_003550197.1| PREDICTED: probable receptor-like protein kinase At5g39020-like [Glycine max] Length = 619 Score = 80.9 bits (198), Expect = 3e-13 Identities = 37/59 (62%), Positives = 45/59 (76%) Frame = +1 Query: 640 CGIIPNISDPFRLKDDPKNCGDPKYELACENNVAFMYLNSQKYLVKAVNYGNSTIRLAD 816 CG I NI+ PFRLK PK+CGD +YELACENNV ++L S KY V+A+NY N TIR+ D Sbjct: 34 CGKITNITYPFRLKGHPKSCGDNRYELACENNVTVLHLYSGKYHVQAINYNNFTIRVVD 92 >ref|XP_003550196.1| PREDICTED: probable receptor-like protein kinase At5g39020-like [Glycine max] Length = 623 Score = 80.9 bits (198), Expect = 3e-13 Identities = 37/59 (62%), Positives = 45/59 (76%) Frame = +1 Query: 640 CGIIPNISDPFRLKDDPKNCGDPKYELACENNVAFMYLNSQKYLVKAVNYGNSTIRLAD 816 CG I NI+ PFRLK PK+CGD +YELACENNV ++L S KY V+A+NY N TIR+ D Sbjct: 34 CGKITNITYPFRLKGHPKSCGDNRYELACENNVTVLHLYSGKYHVQAINYNNFTIRVVD 92 >ref|XP_003550194.1| PREDICTED: probable receptor-like protein kinase At5g39020-like [Glycine max] Length = 605 Score = 80.9 bits (198), Expect = 3e-13 Identities = 37/59 (62%), Positives = 45/59 (76%) Frame = +1 Query: 640 CGIIPNISDPFRLKDDPKNCGDPKYELACENNVAFMYLNSQKYLVKAVNYGNSTIRLAD 816 CG I NI+ PFRLK PK+CGD +YELACENNV ++L S KY V+A+NY N TIR+ D Sbjct: 34 CGKITNITYPFRLKGHPKSCGDNRYELACENNVTVLHLYSGKYHVQAINYNNFTIRVVD 92 >ref|NP_001237957.1| stress-induced receptor-like kinase precursor [Glycine max] gi|212717129|gb|ACJ37406.1| stress-induced receptor-like kinase [Glycine max] Length = 606 Score = 80.9 bits (198), Expect = 3e-13 Identities = 37/59 (62%), Positives = 45/59 (76%) Frame = +1 Query: 640 CGIIPNISDPFRLKDDPKNCGDPKYELACENNVAFMYLNSQKYLVKAVNYGNSTIRLAD 816 CG I NI+ PFRLK PK+CGD +YELACENNV ++L S KY V+A+NY N TIR+ D Sbjct: 34 CGKITNITYPFRLKGHPKSCGDNRYELACENNVTVLHLYSGKYHVQAINYNNFTIRVVD 92