BLASTX nr result
ID: Salvia21_contig00016137
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Salvia21_contig00016137 (364 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002272682.1| PREDICTED: mitochondrial thiamine pyrophosph... 70 2e-10 ref|XP_004172379.1| PREDICTED: mitochondrial thiamine pyrophosph... 69 3e-10 ref|XP_004143086.1| PREDICTED: mitochondrial thiamine pyrophosph... 69 3e-10 ref|XP_003546375.1| PREDICTED: mitochondrial thiamine pyrophosph... 69 4e-10 ref|NP_001242812.1| uncharacterized protein LOC100805353 [Glycin... 69 4e-10 >ref|XP_002272682.1| PREDICTED: mitochondrial thiamine pyrophosphate carrier [Vitis vinifera] gi|297736865|emb|CBI26066.3| unnamed protein product [Vitis vinifera] Length = 330 Score = 69.7 bits (169), Expect = 2e-10 Identities = 33/48 (68%), Positives = 40/48 (83%) Frame = -3 Query: 362 VQGLQRDRRYGARLEPRAYRNMHDAVVQILRAEGSAGLYKGIVPSVIK 219 ++GL RD +YGAR+E RAY NM+DA+ QIL EG AGLYKGIVPS+IK Sbjct: 259 IEGLPRDPKYGARVEHRAYTNMYDALRQILLVEGWAGLYKGIVPSIIK 306 >ref|XP_004172379.1| PREDICTED: mitochondrial thiamine pyrophosphate carrier-like, partial [Cucumis sativus] Length = 219 Score = 69.3 bits (168), Expect = 3e-10 Identities = 31/48 (64%), Positives = 40/48 (83%) Frame = -3 Query: 362 VQGLQRDRRYGARLEPRAYRNMHDAVVQILRAEGSAGLYKGIVPSVIK 219 ++GLQR RYGAR+E AYRNM DA+ +IL+ EG+AGLYKGI+PS +K Sbjct: 144 IEGLQRHPRYGARVEQHAYRNMFDALRRILKKEGTAGLYKGIIPSTVK 191 >ref|XP_004143086.1| PREDICTED: mitochondrial thiamine pyrophosphate carrier-like [Cucumis sativus] Length = 340 Score = 69.3 bits (168), Expect = 3e-10 Identities = 31/48 (64%), Positives = 40/48 (83%) Frame = -3 Query: 362 VQGLQRDRRYGARLEPRAYRNMHDAVVQILRAEGSAGLYKGIVPSVIK 219 ++GLQR RYGAR+E AYRNM DA+ +IL+ EG+AGLYKGI+PS +K Sbjct: 265 IEGLQRHPRYGARVEQHAYRNMFDALRRILKKEGTAGLYKGIIPSTVK 312 >ref|XP_003546375.1| PREDICTED: mitochondrial thiamine pyrophosphate carrier-like [Glycine max] Length = 328 Score = 68.9 bits (167), Expect = 4e-10 Identities = 33/48 (68%), Positives = 40/48 (83%) Frame = -3 Query: 362 VQGLQRDRRYGARLEPRAYRNMHDAVVQILRAEGSAGLYKGIVPSVIK 219 ++GLQR RYGAR+E RAY+NM DAV +IL+ EG AGLYKGIVPS +K Sbjct: 257 IEGLQRHPRYGARVEHRAYKNMLDAVKRILQMEGWAGLYKGIVPSTVK 304 >ref|NP_001242812.1| uncharacterized protein LOC100805353 [Glycine max] gi|255637169|gb|ACU18915.1| unknown [Glycine max] Length = 327 Score = 68.9 bits (167), Expect = 4e-10 Identities = 32/48 (66%), Positives = 39/48 (81%) Frame = -3 Query: 362 VQGLQRDRRYGARLEPRAYRNMHDAVVQILRAEGSAGLYKGIVPSVIK 219 ++GLQR RYGAR+E RAYRNM DA+ +I R EG AGLYKGI+PS +K Sbjct: 256 IEGLQRHPRYGARVEHRAYRNMPDAMQRIFRLEGWAGLYKGIIPSTVK 303