BLASTX nr result
ID: Salvia21_contig00015789
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Salvia21_contig00015789 (240 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AFK36989.1| unknown [Medicago truncatula] 67 1e-09 gb|AFK35490.1| unknown [Medicago truncatula] 67 1e-09 ref|XP_003610595.1| Proline-rich protein [Medicago truncatula] g... 67 1e-09 gb|ACF74351.1| putative metal ion-binding protein [Arachis hypog... 66 3e-09 ref|XP_002522884.1| conserved hypothetical protein [Ricinus comm... 63 3e-08 >gb|AFK36989.1| unknown [Medicago truncatula] Length = 209 Score = 67.4 bits (163), Expect = 1e-09 Identities = 30/43 (69%), Positives = 36/43 (83%) Frame = -3 Query: 238 VYDEKKNEVKVTVVCCSPEKIRDKLCCKGGKSIKTIKIVDLKP 110 VYDEK N V +TVVCCSPEKIRDK+CCKG +IK+I+IV+ P Sbjct: 41 VYDEKNNIVTITVVCCSPEKIRDKICCKGCGAIKSIEIVEPPP 83 >gb|AFK35490.1| unknown [Medicago truncatula] Length = 261 Score = 67.4 bits (163), Expect = 1e-09 Identities = 30/43 (69%), Positives = 36/43 (83%) Frame = -3 Query: 238 VYDEKKNEVKVTVVCCSPEKIRDKLCCKGGKSIKTIKIVDLKP 110 VYDEK N V +TVVCCSPEKIRDK+CCKG +IK+I+IV+ P Sbjct: 41 VYDEKNNIVTITVVCCSPEKIRDKICCKGCGAIKSIEIVEPPP 83 >ref|XP_003610595.1| Proline-rich protein [Medicago truncatula] gi|355511650|gb|AES92792.1| Proline-rich protein [Medicago truncatula] Length = 261 Score = 67.4 bits (163), Expect = 1e-09 Identities = 30/43 (69%), Positives = 36/43 (83%) Frame = -3 Query: 238 VYDEKKNEVKVTVVCCSPEKIRDKLCCKGGKSIKTIKIVDLKP 110 VYDEK N V +TVVCCSPEKIRDK+CCKG +IK+I+IV+ P Sbjct: 41 VYDEKNNIVTITVVCCSPEKIRDKICCKGCGAIKSIEIVEPPP 83 >gb|ACF74351.1| putative metal ion-binding protein [Arachis hypogaea] Length = 232 Score = 66.2 bits (160), Expect = 3e-09 Identities = 30/39 (76%), Positives = 35/39 (89%) Frame = -3 Query: 235 YDEKKNEVKVTVVCCSPEKIRDKLCCKGGKSIKTIKIVD 119 +DEK+N V +TVVCCSPEKIRDKLC KGG SIK+I+IVD Sbjct: 38 FDEKQNIVTITVVCCSPEKIRDKLCYKGGGSIKSIEIVD 76 >ref|XP_002522884.1| conserved hypothetical protein [Ricinus communis] gi|223537869|gb|EEF39484.1| conserved hypothetical protein [Ricinus communis] Length = 274 Score = 62.8 bits (151), Expect = 3e-08 Identities = 26/38 (68%), Positives = 32/38 (84%) Frame = -3 Query: 238 VYDEKKNEVKVTVVCCSPEKIRDKLCCKGGKSIKTIKI 125 +YDEK N V +TVVCCSPEKI+ K+CCKGG +IK I+I Sbjct: 38 IYDEKANTVTITVVCCSPEKIKKKICCKGGDTIKGIEI 75