BLASTX nr result
ID: Salvia21_contig00015451
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Salvia21_contig00015451 (296 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002519151.1| protein binding protein, putative [Ricinus c... 55 8e-06 >ref|XP_002519151.1| protein binding protein, putative [Ricinus communis] gi|223541814|gb|EEF43362.1| protein binding protein, putative [Ricinus communis] Length = 829 Score = 54.7 bits (130), Expect = 8e-06 Identities = 27/61 (44%), Positives = 40/61 (65%) Frame = +2 Query: 59 ASFRINSNRFCGIVPDYL*KIEELFELYLRNSLIVGFFENSIIKSWVSQKMMDVFDDEVE 238 A F INSNRFCGIVP+ L K++ ++E + N+ VG F N ++K W + K +D+ + E Sbjct: 144 ALFHINSNRFCGIVPESLSKLKFMYEFDISNNRFVGHFPNVVLK-WPNVKYIDIRFNNFE 202 Query: 239 G 241 G Sbjct: 203 G 203