BLASTX nr result
ID: Salvia21_contig00015250
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Salvia21_contig00015250 (296 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002521006.1| Proteinase inhibitor, putative [Ricinus comm... 59 3e-07 >ref|XP_002521006.1| Proteinase inhibitor, putative [Ricinus communis] gi|223539843|gb|EEF41423.1| Proteinase inhibitor, putative [Ricinus communis] Length = 69 Score = 59.3 bits (142), Expect = 3e-07 Identities = 26/45 (57%), Positives = 35/45 (77%) Frame = +3 Query: 6 IEKENYGVKAIIVVPGQPIFGNFSCARVWVFVDDDGIVTRVPTIG 140 IEKEN V AI++ G P+ +F C+RVWV+VD++G+VTR PTIG Sbjct: 25 IEKENKYVDAIVLKEGTPVTKDFRCSRVWVWVDENGVVTRTPTIG 69