BLASTX nr result
ID: Salvia21_contig00015044
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Salvia21_contig00015044 (258 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAS45236.1| phytochelatin synthase 1 [Arabidopsis halleri] 87 1e-15 dbj|BAB93119.1| phytochelatin synthase [Thlaspi japonicum] 87 1e-15 dbj|BAB93120.1| phytochelatin synthase [Thlaspi caerulescens] 87 1e-15 gb|AEW23125.1| phytochelatin synthase [Amaranthus tricolor] 87 1e-15 gb|ACL80669.1| phytochelatin synthase [Noccaea caerulescens] 87 1e-15 >gb|AAS45236.1| phytochelatin synthase 1 [Arabidopsis halleri] Length = 485 Score = 87.4 bits (215), Expect = 1e-15 Identities = 38/48 (79%), Positives = 43/48 (89%) Frame = +3 Query: 3 ARFKYPPHWVPLSLLWEAMDSTDEATGQKRGFMLVSRHQREPALLHTL 146 ARFKYPPHWVPL LLWEAMDS DE+TG++RGFML+SR REP LL+TL Sbjct: 182 ARFKYPPHWVPLKLLWEAMDSIDESTGKRRGFMLISRPHREPGLLYTL 229 >dbj|BAB93119.1| phytochelatin synthase [Thlaspi japonicum] Length = 485 Score = 87.4 bits (215), Expect = 1e-15 Identities = 38/48 (79%), Positives = 43/48 (89%) Frame = +3 Query: 3 ARFKYPPHWVPLSLLWEAMDSTDEATGQKRGFMLVSRHQREPALLHTL 146 ARFKYPPHWVPL LLWEAMDS DE+TG++RGFML+SR REP LL+TL Sbjct: 182 ARFKYPPHWVPLKLLWEAMDSIDESTGKRRGFMLISRPHREPGLLYTL 229 >dbj|BAB93120.1| phytochelatin synthase [Thlaspi caerulescens] Length = 485 Score = 87.4 bits (215), Expect = 1e-15 Identities = 38/48 (79%), Positives = 43/48 (89%) Frame = +3 Query: 3 ARFKYPPHWVPLSLLWEAMDSTDEATGQKRGFMLVSRHQREPALLHTL 146 ARFKYPPHWVPL LLWEAMDS DE+TG++RGFML+SR REP LL+TL Sbjct: 182 ARFKYPPHWVPLKLLWEAMDSIDESTGKRRGFMLISRPHREPGLLYTL 229 >gb|AEW23125.1| phytochelatin synthase [Amaranthus tricolor] Length = 485 Score = 87.0 bits (214), Expect = 1e-15 Identities = 38/48 (79%), Positives = 42/48 (87%) Frame = +3 Query: 3 ARFKYPPHWVPLSLLWEAMDSTDEATGQKRGFMLVSRHQREPALLHTL 146 ARFKYPPHWVPL LLWEAMDS DE TG++RGFML+SR REP LL+TL Sbjct: 182 ARFKYPPHWVPLKLLWEAMDSIDETTGKRRGFMLISRPHREPGLLYTL 229 >gb|ACL80669.1| phytochelatin synthase [Noccaea caerulescens] Length = 485 Score = 87.0 bits (214), Expect = 1e-15 Identities = 38/48 (79%), Positives = 42/48 (87%) Frame = +3 Query: 3 ARFKYPPHWVPLSLLWEAMDSTDEATGQKRGFMLVSRHQREPALLHTL 146 ARFKYPPHWVPL LLWEAMDS DE TG++RGFML+SR REP LL+TL Sbjct: 182 ARFKYPPHWVPLKLLWEAMDSIDETTGKRRGFMLISRPHREPGLLYTL 229