BLASTX nr result
ID: Salvia21_contig00014874
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Salvia21_contig00014874 (283 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAF79631.1|AC025416_5 F5O11.7 [Arabidopsis thaliana] 126 2e-27 ref|XP_002513850.1| cornichon, putative [Ricinus communis] gi|22... 126 2e-27 ref|NP_563904.2| phosphopantothenate--cysteine ligase 1 [Arabido... 126 2e-27 ref|XP_002889929.1| predicted protein [Arabidopsis lyrata subsp.... 125 4e-27 sp|Q9LZM3.2|PPCS2_ARATH RecName: Full=Phosphopantothenate--cyste... 122 2e-26 >gb|AAF79631.1|AC025416_5 F5O11.7 [Arabidopsis thaliana] Length = 455 Score = 126 bits (316), Expect = 2e-27 Identities = 60/82 (73%), Positives = 73/82 (89%) Frame = -1 Query: 277 HKIQSSSGPLDMRLAQVPKMLLVLRRDWAPKAFCISFKLETDKEILLKKAGAALEKYNMN 98 HKI+S SGPLD+RLAQVPKML +LR +WAPKAFCISFKLETD +ILL+KA AL+KY ++ Sbjct: 339 HKIESGSGPLDIRLAQVPKMLSILRSNWAPKAFCISFKLETDSKILLEKATKALQKYKVH 398 Query: 97 MVIANELLTRKEEVIVVTKAGN 32 V+ANELLTRKEEV+VV+ +GN Sbjct: 399 AVVANELLTRKEEVVVVSSSGN 420 >ref|XP_002513850.1| cornichon, putative [Ricinus communis] gi|223546936|gb|EEF48433.1| cornichon, putative [Ricinus communis] Length = 277 Score = 126 bits (316), Expect = 2e-27 Identities = 63/80 (78%), Positives = 71/80 (88%) Frame = -1 Query: 283 AVHKIQSSSGPLDMRLAQVPKMLLVLRRDWAPKAFCISFKLETDKEILLKKAGAALEKYN 104 A HKIQS+SGPLDMRL QVPKML V R++WAP AFCISFKLETD +ILL+KA AL+KY Sbjct: 159 AEHKIQSASGPLDMRLVQVPKMLSVFRKEWAPMAFCISFKLETDSKILLEKADMALKKYK 218 Query: 103 MNMVIANELLTRKEEVIVVT 44 M++VIANELLTRKEEVIVVT Sbjct: 219 MHVVIANELLTRKEEVIVVT 238 >ref|NP_563904.2| phosphopantothenate--cysteine ligase 1 [Arabidopsis thaliana] gi|75151271|sp|Q8GXR5.1|PPCS1_ARATH RecName: Full=Phosphopantothenate--cysteine ligase 1; AltName: Full=Phosphopantothenoylcysteine synthetase 1; Short=PPC synthetase 1 gi|26451224|dbj|BAC42714.1| unknown protein [Arabidopsis thaliana] gi|332190748|gb|AEE28869.1| phosphopantothenate--cysteine ligase 1 [Arabidopsis thaliana] Length = 317 Score = 126 bits (316), Expect = 2e-27 Identities = 60/82 (73%), Positives = 73/82 (89%) Frame = -1 Query: 277 HKIQSSSGPLDMRLAQVPKMLLVLRRDWAPKAFCISFKLETDKEILLKKAGAALEKYNMN 98 HKI+S SGPLD+RLAQVPKML +LR +WAPKAFCISFKLETD +ILL+KA AL+KY ++ Sbjct: 201 HKIESGSGPLDIRLAQVPKMLSILRSNWAPKAFCISFKLETDSKILLEKATKALQKYKVH 260 Query: 97 MVIANELLTRKEEVIVVTKAGN 32 V+ANELLTRKEEV+VV+ +GN Sbjct: 261 AVVANELLTRKEEVVVVSSSGN 282 >ref|XP_002889929.1| predicted protein [Arabidopsis lyrata subsp. lyrata] gi|297335771|gb|EFH66188.1| predicted protein [Arabidopsis lyrata subsp. lyrata] Length = 317 Score = 125 bits (314), Expect = 4e-27 Identities = 59/82 (71%), Positives = 73/82 (89%) Frame = -1 Query: 277 HKIQSSSGPLDMRLAQVPKMLLVLRRDWAPKAFCISFKLETDKEILLKKAGAALEKYNMN 98 HKI+S SGPLD+RLAQVPKML +LR +WAPKAFCISFKLETD +IL++KA AL+KY ++ Sbjct: 201 HKIESGSGPLDIRLAQVPKMLSILRSNWAPKAFCISFKLETDSKILIEKATKALQKYKVH 260 Query: 97 MVIANELLTRKEEVIVVTKAGN 32 V+ANELLTRKEEV+VV+ +GN Sbjct: 261 AVVANELLTRKEEVVVVSSSGN 282 >sp|Q9LZM3.2|PPCS2_ARATH RecName: Full=Phosphopantothenate--cysteine ligase 2; AltName: Full=Phosphopantothenoylcysteine synthetase 2; Short=PPC synthetase 2 Length = 309 Score = 122 bits (307), Expect = 2e-26 Identities = 59/82 (71%), Positives = 71/82 (86%) Frame = -1 Query: 277 HKIQSSSGPLDMRLAQVPKMLLVLRRDWAPKAFCISFKLETDKEILLKKAGAALEKYNMN 98 HKI+S SGPLD+RLAQVPKML VLR +WAPKAFCISFKLETD +IL++KA AL KY ++ Sbjct: 193 HKIESGSGPLDIRLAQVPKMLSVLRSNWAPKAFCISFKLETDSKILMEKATKALRKYKVH 252 Query: 97 MVIANELLTRKEEVIVVTKAGN 32 V+ANEL TRKEEV+VV+ +GN Sbjct: 253 AVVANELSTRKEEVVVVSSSGN 274