BLASTX nr result
ID: Salvia21_contig00014640
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Salvia21_contig00014640 (403 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value sp|P34800.1|CCN1_ANTMA RecName: Full=G2/mitotic-specific cyclin-... 58 9e-07 emb|CAQ17045.1| B-type cyclin [Olea europaea] 58 9e-07 gb|AAF88072.1| cyclin [Cicer arietinum] 57 2e-06 sp|P34801.1|CCN2_ANTMA RecName: Full=G2/mitotic-specific cyclin-... 55 6e-06 gb|AAN87005.1| cyclin B [Populus alba] 55 8e-06 >sp|P34800.1|CCN1_ANTMA RecName: Full=G2/mitotic-specific cyclin-1 gi|425261|emb|CAA53728.1| mitotic-like cyclin [Antirrhinum majus] Length = 473 Score = 57.8 bits (138), Expect = 9e-07 Identities = 28/34 (82%), Positives = 31/34 (91%) Frame = -3 Query: 290 IVDIDA*DLGNDLAVVEYVEEIYKFYKSVENE*R 189 IVDIDA D+ NDLAVVEYVE++YKFYKSVENE R Sbjct: 177 IVDIDAADVNNDLAVVEYVEDMYKFYKSVENESR 210 >emb|CAQ17045.1| B-type cyclin [Olea europaea] Length = 76 Score = 57.8 bits (138), Expect = 9e-07 Identities = 31/56 (55%), Positives = 40/56 (71%), Gaps = 3/56 (5%) Frame = -3 Query: 290 IVDIDA*DLGNDLAVVEYVEEIYKFYKSVENE*RA*AVI---*KLSEAESSVSLEW 132 IVDIDA D+ NDLA VEYVEEIYK+YKSVENE R I +++E ++ ++W Sbjct: 9 IVDIDAADVNNDLAAVEYVEEIYKYYKSVENESRVNYYIDSQPEINEKMRAILIDW 64 >gb|AAF88072.1| cyclin [Cicer arietinum] Length = 505 Score = 57.0 bits (136), Expect = 2e-06 Identities = 28/34 (82%), Positives = 31/34 (91%) Frame = -3 Query: 290 IVDIDA*DLGNDLAVVEYVEEIYKFYKSVENE*R 189 IVDIDA D+ NDLAVVEYVE++YKFYKSVENE R Sbjct: 177 IVDIDAADVTNDLAVVEYVEDMYKFYKSVENESR 210 >sp|P34801.1|CCN2_ANTMA RecName: Full=G2/mitotic-specific cyclin-2 gi|425263|emb|CAA53729.1| mitotic-like cyclin [Antirrhinum majus] Length = 441 Score = 55.1 bits (131), Expect = 6e-06 Identities = 26/34 (76%), Positives = 30/34 (88%) Frame = -3 Query: 290 IVDIDA*DLGNDLAVVEYVEEIYKFYKSVENE*R 189 IVDIDA D+ NDLAVVEYVE++YKFYKS EN+ R Sbjct: 172 IVDIDAADVNNDLAVVEYVEDMYKFYKSAENDSR 205 >gb|AAN87005.1| cyclin B [Populus alba] Length = 211 Score = 54.7 bits (130), Expect = 8e-06 Identities = 29/45 (64%), Positives = 34/45 (75%) Frame = -3 Query: 323 CGLRAILQAAMIVDIDA*DLGNDLAVVEYVEEIYKFYKSVENE*R 189 CG+ L+ I+DIDA D+ NDLA VEYVE+IYKFYK VENE R Sbjct: 99 CGIANKLKE-QIIDIDAADVNNDLAGVEYVEDIYKFYKLVENESR 142