BLASTX nr result
ID: Salvia21_contig00013532
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Salvia21_contig00013532 (527 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004152897.1| PREDICTED: iron-sulfur assembly protein IscA... 62 4e-08 ref|XP_002282626.1| PREDICTED: iron-sulfur assembly protein IscA... 62 4e-08 ref|XP_004147288.1| PREDICTED: iron-sulfur assembly protein IscA... 61 1e-07 ref|XP_003572142.1| PREDICTED: iron-sulfur assembly protein IscA... 60 2e-07 ref|XP_002445380.1| hypothetical protein SORBIDRAFT_07g014910 [S... 60 2e-07 >ref|XP_004152897.1| PREDICTED: iron-sulfur assembly protein IscA-like 2, mitochondrial-like [Cucumis sativus] gi|449505888|ref|XP_004162595.1| PREDICTED: iron-sulfur assembly protein IscA-like 2, mitochondrial-like [Cucumis sativus] Length = 157 Score = 62.4 bits (150), Expect = 4e-08 Identities = 29/32 (90%), Positives = 30/32 (93%) Frame = -3 Query: 525 DYVDELIRSAFQVSTNPSAVGGCSCKSSFMAK 430 DYV+ELIRSAF VSTNPSAVGGCSCKSSFM K Sbjct: 125 DYVEELIRSAFVVSTNPSAVGGCSCKSSFMVK 156 >ref|XP_002282626.1| PREDICTED: iron-sulfur assembly protein IscA-like 2, mitochondrial [Vitis vinifera] gi|297740113|emb|CBI30295.3| unnamed protein product [Vitis vinifera] Length = 154 Score = 62.4 bits (150), Expect = 4e-08 Identities = 29/32 (90%), Positives = 30/32 (93%) Frame = -3 Query: 525 DYVDELIRSAFQVSTNPSAVGGCSCKSSFMAK 430 DYV+ELIRSAF VSTNPSAVGGCSCKSSFM K Sbjct: 122 DYVEELIRSAFLVSTNPSAVGGCSCKSSFMVK 153 >ref|XP_004147288.1| PREDICTED: iron-sulfur assembly protein IscA-like 2, mitochondrial-like [Cucumis sativus] Length = 155 Score = 60.8 bits (146), Expect = 1e-07 Identities = 28/32 (87%), Positives = 30/32 (93%) Frame = -3 Query: 525 DYVDELIRSAFQVSTNPSAVGGCSCKSSFMAK 430 DYV+ELIRSAF V+TNPSAVGGCSCKSSFM K Sbjct: 123 DYVEELIRSAFIVTTNPSAVGGCSCKSSFMVK 154 >ref|XP_003572142.1| PREDICTED: iron-sulfur assembly protein IscA-like 2, mitochondrial-like [Brachypodium distachyon] Length = 231 Score = 60.1 bits (144), Expect = 2e-07 Identities = 28/32 (87%), Positives = 29/32 (90%) Frame = -3 Query: 525 DYVDELIRSAFQVSTNPSAVGGCSCKSSFMAK 430 DY +ELIRSAF VSTNPSAVGGCSCKSSFM K Sbjct: 200 DYEEELIRSAFVVSTNPSAVGGCSCKSSFMVK 231 >ref|XP_002445380.1| hypothetical protein SORBIDRAFT_07g014910 [Sorghum bicolor] gi|241941730|gb|EES14875.1| hypothetical protein SORBIDRAFT_07g014910 [Sorghum bicolor] Length = 159 Score = 60.1 bits (144), Expect = 2e-07 Identities = 28/32 (87%), Positives = 29/32 (90%) Frame = -3 Query: 525 DYVDELIRSAFQVSTNPSAVGGCSCKSSFMAK 430 DY +ELIRSAF VSTNPSAVGGCSCKSSFM K Sbjct: 128 DYEEELIRSAFVVSTNPSAVGGCSCKSSFMVK 159