BLASTX nr result
ID: Salvia21_contig00012945
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Salvia21_contig00012945 (323 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAG43556.1|AF211538_1 Avr9/Cf-9 rapidly elicited protein 180 ... 54 5e-06 >gb|AAG43556.1|AF211538_1 Avr9/Cf-9 rapidly elicited protein 180 [Nicotiana tabacum] Length = 102 Score = 53.9 bits (128), Expect(2) = 5e-06 Identities = 29/64 (45%), Positives = 45/64 (70%), Gaps = 4/64 (6%) Frame = +2 Query: 74 EQEGERERLHNGSD-SAWRWKLKS-SAGLRWKKR--FNLHLWFINDVVFKVVSVSEAMSL 241 + +GE R H+ S ++ RW+ K+ S+GLRW K+ + LH WF++ +FK+VSV EA++L Sbjct: 28 DSKGEITRDHDISKPTSLRWRFKNLSSGLRWNKKSLYKLHHWFVDSFLFKIVSVFEAIAL 87 Query: 242 VSAL 253 VS L Sbjct: 88 VSTL 91 Score = 21.2 bits (43), Expect(2) = 5e-06 Identities = 8/15 (53%), Positives = 11/15 (73%) Frame = +3 Query: 45 SNFSLIFKRLNKKGS 89 S + FK+LNKKG+ Sbjct: 4 SGYLFSFKKLNKKGN 18