BLASTX nr result
ID: Salvia21_contig00012655
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Salvia21_contig00012655 (336 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AFK34026.1| unknown [Medicago truncatula] 89 5e-16 ref|NP_001237603.1| ubiquitin carrier protein 4 [Glycine max] gi... 87 1e-15 ref|XP_003548669.1| PREDICTED: ubiquitin-conjugating enzyme E2 5... 87 1e-15 ref|XP_002276343.1| PREDICTED: ubiquitin-conjugating enzyme E2 5... 87 1e-15 ref|XP_003627554.1| Ubiquitin carrier protein [Medicago truncatu... 87 1e-15 >gb|AFK34026.1| unknown [Medicago truncatula] Length = 185 Score = 88.6 bits (218), Expect = 5e-16 Identities = 41/42 (97%), Positives = 42/42 (100%) Frame = -1 Query: 126 MSSPSKRREMDLMKLLMSDYKVEMINDGMQEFYVHFHGPSES 1 MSSPSKRREMDLMKL+MSDYKVEMINDGMQEFYVHFHGPSES Sbjct: 1 MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVHFHGPSES 42 >ref|NP_001237603.1| ubiquitin carrier protein 4 [Glycine max] gi|6066285|gb|AAF03236.1|AF180143_1 ubiquitin carrier protein 4 [Glycine max] Length = 183 Score = 87.4 bits (215), Expect = 1e-15 Identities = 40/42 (95%), Positives = 42/42 (100%) Frame = -1 Query: 126 MSSPSKRREMDLMKLLMSDYKVEMINDGMQEFYVHFHGPSES 1 MSSPSKRREMDLMKL+MSDYKVEMINDGMQEFYVHFHGP+ES Sbjct: 1 MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVHFHGPNES 42 >ref|XP_003548669.1| PREDICTED: ubiquitin-conjugating enzyme E2 5-like [Glycine max] Length = 183 Score = 87.4 bits (215), Expect = 1e-15 Identities = 40/42 (95%), Positives = 42/42 (100%) Frame = -1 Query: 126 MSSPSKRREMDLMKLLMSDYKVEMINDGMQEFYVHFHGPSES 1 MSSPSKRREMDLMKL+MSDYKVEMINDGMQEFYVHFHGP+ES Sbjct: 1 MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVHFHGPNES 42 >ref|XP_002276343.1| PREDICTED: ubiquitin-conjugating enzyme E2 5 [Vitis vinifera] gi|147789691|emb|CAN74060.1| hypothetical protein VITISV_024680 [Vitis vinifera] gi|297745317|emb|CBI40397.3| unnamed protein product [Vitis vinifera] Length = 184 Score = 87.4 bits (215), Expect = 1e-15 Identities = 40/42 (95%), Positives = 42/42 (100%) Frame = -1 Query: 126 MSSPSKRREMDLMKLLMSDYKVEMINDGMQEFYVHFHGPSES 1 MSSPSKRREMDLMKL+MSDYKVEMINDGMQEFYVHFHGPS+S Sbjct: 1 MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVHFHGPSDS 42 >ref|XP_003627554.1| Ubiquitin carrier protein [Medicago truncatula] gi|355521576|gb|AET02030.1| Ubiquitin carrier protein [Medicago truncatula] Length = 191 Score = 87.0 bits (214), Expect = 1e-15 Identities = 40/41 (97%), Positives = 41/41 (100%) Frame = -1 Query: 126 MSSPSKRREMDLMKLLMSDYKVEMINDGMQEFYVHFHGPSE 4 MSSPSKRREMDLMKL+MSDYKVEMINDGMQEFYVHFHGPSE Sbjct: 1 MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVHFHGPSE 41