BLASTX nr result
ID: Salvia21_contig00012546
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Salvia21_contig00012546 (193 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI35924.3| unnamed protein product [Vitis vinifera] 55 6e-06 ref|XP_002274941.1| PREDICTED: puromycin-sensitive aminopeptidas... 55 6e-06 >emb|CBI35924.3| unnamed protein product [Vitis vinifera] Length = 863 Score = 55.1 bits (131), Expect = 6e-06 Identities = 26/45 (57%), Positives = 35/45 (77%) Frame = +3 Query: 6 NTRKAAYVAVMRNTSSADKTGLRWLQKLYKEVDAVQEKTRILRKV 140 +T++AAY+AVMRNTSS ++TG L K+Y+E D VQEK ILR + Sbjct: 687 DTKRAAYIAVMRNTSSTNRTGYESLLKVYRESDGVQEKEPILRSL 731 >ref|XP_002274941.1| PREDICTED: puromycin-sensitive aminopeptidase-like [Vitis vinifera] Length = 889 Score = 55.1 bits (131), Expect = 6e-06 Identities = 26/45 (57%), Positives = 35/45 (77%) Frame = +3 Query: 6 NTRKAAYVAVMRNTSSADKTGLRWLQKLYKEVDAVQEKTRILRKV 140 +T++AAY+AVMRNTSS ++TG L K+Y+E D VQEK ILR + Sbjct: 713 DTKRAAYIAVMRNTSSTNRTGYESLLKVYRESDGVQEKEPILRSL 757