BLASTX nr result
ID: Salvia21_contig00012355
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Salvia21_contig00012355 (790 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002521599.1| conserved hypothetical protein [Ricinus comm... 81 3e-13 ref|XP_003611987.1| hypothetical protein MTR_5g020060 [Medicago ... 80 5e-13 ref|NP_201479.1| uncharacterized protein [Arabidopsis thaliana] ... 76 7e-12 ref|XP_002866738.1| hypothetical protein ARALYDRAFT_496922 [Arab... 73 6e-11 ref|XP_002466547.1| hypothetical protein SORBIDRAFT_01g009730 [S... 69 9e-10 >ref|XP_002521599.1| conserved hypothetical protein [Ricinus communis] gi|223539277|gb|EEF40870.1| conserved hypothetical protein [Ricinus communis] Length = 131 Score = 80.9 bits (198), Expect = 3e-13 Identities = 41/63 (65%), Positives = 48/63 (76%), Gaps = 1/63 (1%) Frame = +1 Query: 265 DSMS-SLGEGYATRSDEEGFGGIYRGNQSLSEDGDDKNVHADALEFDHDQGSHVKEKEKA 441 D MS S GEGYATRSDEEGFGGIY GNQS+ ++ DK +H + +D QGS VKEKEKA Sbjct: 64 DVMSHSFGEGYATRSDEEGFGGIYGGNQSVVKEETDKEIHENHPAYDTSQGSEVKEKEKA 123 Query: 442 RNQ 450 R+Q Sbjct: 124 RHQ 126 >ref|XP_003611987.1| hypothetical protein MTR_5g020060 [Medicago truncatula] gi|355513322|gb|AES94945.1| hypothetical protein MTR_5g020060 [Medicago truncatula] Length = 126 Score = 80.1 bits (196), Expect = 5e-13 Identities = 43/64 (67%), Positives = 50/64 (78%), Gaps = 1/64 (1%) Frame = +1 Query: 265 DSMS-SLGEGYATRSDEEGFGGIYRGNQSLSEDGDDKNVHADALEFDHDQGSHVKEKEKA 441 D MS S GEGYATRSDEEGFGGIY GNQSL + DK+VH + ++D QGS VKEKEKA Sbjct: 62 DVMSHSFGEGYATRSDEEGFGGIYGGNQSLQK---DKSVHENHPDYDKTQGSEVKEKEKA 118 Query: 442 RNQA 453 R+Q+ Sbjct: 119 RHQS 122 >ref|NP_201479.1| uncharacterized protein [Arabidopsis thaliana] gi|9758128|dbj|BAB08620.1| unnamed protein product [Arabidopsis thaliana] gi|15081694|gb|AAK82502.1| AT5g66780/MUD21_2 [Arabidopsis thaliana] gi|18252267|gb|AAL62014.1| AT5g66780/MUD21_2 [Arabidopsis thaliana] gi|332010879|gb|AED98262.1| uncharacterized protein [Arabidopsis thaliana] Length = 121 Score = 76.3 bits (186), Expect = 7e-12 Identities = 40/65 (61%), Positives = 48/65 (73%), Gaps = 1/65 (1%) Frame = +1 Query: 265 DSMS-SLGEGYATRSDEEGFGGIYRGNQSLSEDGDDKNVHADALEFDHDQGSHVKEKEKA 441 D MS S GEGYATRSDEEGFGGIY GNQ+L ++ + +H + ++D QGS KEKEKA Sbjct: 57 DVMSHSYGEGYATRSDEEGFGGIYGGNQTLQKENE---IHENHPDYDKTQGSESKEKEKA 113 Query: 442 RNQAQ 456 RNQ Q Sbjct: 114 RNQTQ 118 >ref|XP_002866738.1| hypothetical protein ARALYDRAFT_496922 [Arabidopsis lyrata subsp. lyrata] gi|297312573|gb|EFH42997.1| hypothetical protein ARALYDRAFT_496922 [Arabidopsis lyrata subsp. lyrata] Length = 121 Score = 73.2 bits (178), Expect = 6e-11 Identities = 38/65 (58%), Positives = 46/65 (70%), Gaps = 1/65 (1%) Frame = +1 Query: 265 DSMS-SLGEGYATRSDEEGFGGIYRGNQSLSEDGDDKNVHADALEFDHDQGSHVKEKEKA 441 D MS S GEGYATR DEEGFGG Y GNQ+L ++ + +H + ++D QGS KEKEKA Sbjct: 57 DVMSHSYGEGYATRCDEEGFGGTYGGNQTLQKENE---IHENHPDYDKTQGSEAKEKEKA 113 Query: 442 RNQAQ 456 RNQ Q Sbjct: 114 RNQTQ 118 >ref|XP_002466547.1| hypothetical protein SORBIDRAFT_01g009730 [Sorghum bicolor] gi|241920401|gb|EER93545.1| hypothetical protein SORBIDRAFT_01g009730 [Sorghum bicolor] Length = 176 Score = 69.3 bits (168), Expect = 9e-10 Identities = 36/62 (58%), Positives = 43/62 (69%), Gaps = 1/62 (1%) Frame = +1 Query: 265 DSMS-SLGEGYATRSDEEGFGGIYRGNQSLSEDGDDKNVHADALEFDHDQGSHVKEKEKA 441 D MS S GEGY+TRSDEEGFGG+Y GN + G + +H E+D QGS VKEKEKA Sbjct: 108 DVMSHSFGEGYSTRSDEEGFGGVYGGNDPVEHPGTE--IHPSHPEYDTSQGSEVKEKEKA 165 Query: 442 RN 447 R+ Sbjct: 166 RH 167