BLASTX nr result
ID: Salvia21_contig00012228
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Salvia21_contig00012228 (265 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002282027.2| PREDICTED: interactor of constitutive active... 112 3e-23 emb|CBI16257.3| unnamed protein product [Vitis vinifera] 112 3e-23 ref|XP_003538038.1| PREDICTED: interactor of constitutive active... 108 3e-22 ref|XP_003539735.1| PREDICTED: interactor of constitutive active... 106 2e-21 gb|ACU17370.1| unknown [Glycine max] 106 2e-21 >ref|XP_002282027.2| PREDICTED: interactor of constitutive active ROPs 3-like [Vitis vinifera] Length = 624 Score = 112 bits (280), Expect = 3e-23 Identities = 56/80 (70%), Positives = 69/80 (86%) Frame = -1 Query: 244 TASSSNQASRAPKERSPKVAEHKSPRSPLSEKKRPSKVPELESQISQLEHDLKVVKDQLI 65 +ASSSNQASR PK++SPKV E +SPRSP+SEKKRP+KV ELESQIS+L+ DLK KDQL Sbjct: 35 SASSSNQASRTPKDKSPKVIERRSPRSPVSEKKRPNKVTELESQISKLQEDLKKAKDQLS 94 Query: 64 STEAQKKQAQKDAEESNQQL 5 S+E+ K+ AQ+DAEES +QL Sbjct: 95 SSESWKRSAQQDAEESKKQL 114 >emb|CBI16257.3| unnamed protein product [Vitis vinifera] Length = 684 Score = 112 bits (280), Expect = 3e-23 Identities = 56/80 (70%), Positives = 69/80 (86%) Frame = -1 Query: 244 TASSSNQASRAPKERSPKVAEHKSPRSPLSEKKRPSKVPELESQISQLEHDLKVVKDQLI 65 +ASSSNQASR PK++SPKV E +SPRSP+SEKKRP+KV ELESQIS+L+ DLK KDQL Sbjct: 165 SASSSNQASRTPKDKSPKVIERRSPRSPVSEKKRPNKVTELESQISKLQEDLKKAKDQLS 224 Query: 64 STEAQKKQAQKDAEESNQQL 5 S+E+ K+ AQ+DAEES +QL Sbjct: 225 SSESWKRSAQQDAEESKKQL 244 >ref|XP_003538038.1| PREDICTED: interactor of constitutive active ROPs 3-like [Glycine max] Length = 615 Score = 108 bits (271), Expect = 3e-22 Identities = 57/88 (64%), Positives = 74/88 (84%), Gaps = 1/88 (1%) Frame = -1 Query: 262 PRFLD-PTASSSNQASRAPKERSPKVAEHKSPRSPLSEKKRPSKVPELESQISQLEHDLK 86 P LD +ASS +QA+++ KERSPKV + +SPRSP+ E+KRPSK+ ELESQISQL++DLK Sbjct: 27 PTTLDIDSASSLSQATKSSKERSPKVTDRRSPRSPVVERKRPSKISELESQISQLQNDLK 86 Query: 85 VVKDQLISTEAQKKQAQKDAEESNQQLL 2 VKDQLI +E+ KKQAQ++AEES +QLL Sbjct: 87 KVKDQLILSESCKKQAQQEAEESKEQLL 114 >ref|XP_003539735.1| PREDICTED: interactor of constitutive active ROPs 3-like isoform 1 [Glycine max] gi|356542563|ref|XP_003539736.1| PREDICTED: interactor of constitutive active ROPs 3-like isoform 2 [Glycine max] Length = 615 Score = 106 bits (264), Expect = 2e-21 Identities = 55/88 (62%), Positives = 73/88 (82%), Gaps = 1/88 (1%) Frame = -1 Query: 262 PRFLD-PTASSSNQASRAPKERSPKVAEHKSPRSPLSEKKRPSKVPELESQISQLEHDLK 86 P LD +ASS +QA+++ KERSPKV + +SPRSP+ E+KRPSK+ ELESQISQL++DLK Sbjct: 27 PTTLDIDSASSLSQATKSSKERSPKVTDRRSPRSPVIERKRPSKISELESQISQLQNDLK 86 Query: 85 VVKDQLISTEAQKKQAQKDAEESNQQLL 2 V+DQ I +E+ KKQAQ++AEES +QLL Sbjct: 87 KVRDQFILSESCKKQAQQEAEESKEQLL 114 >gb|ACU17370.1| unknown [Glycine max] Length = 155 Score = 106 bits (264), Expect = 2e-21 Identities = 55/88 (62%), Positives = 73/88 (82%), Gaps = 1/88 (1%) Frame = -1 Query: 262 PRFLD-PTASSSNQASRAPKERSPKVAEHKSPRSPLSEKKRPSKVPELESQISQLEHDLK 86 P LD +ASS +QA+++ KERSPKV + +SPRSP+ E+KRPSK+ ELESQISQL++DLK Sbjct: 27 PTTLDIDSASSLSQATKSSKERSPKVTDRRSPRSPVIERKRPSKISELESQISQLQNDLK 86 Query: 85 VVKDQLISTEAQKKQAQKDAEESNQQLL 2 V+DQ I +E+ KKQAQ++AEES +QLL Sbjct: 87 KVRDQFILSESCKKQAQQEAEESKEQLL 114