BLASTX nr result
ID: Salvia21_contig00011673
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Salvia21_contig00011673 (205 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002528927.1| pepsin A, putative [Ricinus communis] gi|223... 96 3e-18 ref|XP_003631454.1| PREDICTED: aspartic proteinase nepenthesin-2... 95 5e-18 ref|XP_002304273.1| predicted protein [Populus trichocarpa] gi|2... 93 3e-17 ref|XP_003538731.1| PREDICTED: aspartic proteinase nepenthesin-1... 92 3e-17 ref|XP_003611301.1| Aspartic proteinase nepenthesin-2 [Medicago ... 92 6e-17 >ref|XP_002528927.1| pepsin A, putative [Ricinus communis] gi|223531629|gb|EEF33456.1| pepsin A, putative [Ricinus communis] Length = 493 Score = 95.9 bits (237), Expect = 3e-18 Identities = 45/60 (75%), Positives = 50/60 (83%) Frame = -3 Query: 182 VYYSYTPMLYNPKHSYFYCVGLEAVSIGKIKIPAPASLRRVDRRGNGGMVVDSGTTFTML 3 V + YT ML NPKH YFYCVGLE +SIGK KIPAP L+RVDR G+GG+VVDSGTTFTML Sbjct: 294 VQFVYTSMLDNPKHPYFYCVGLEGISIGKKKIPAPEFLKRVDREGSGGVVVDSGTTFTML 353 >ref|XP_003631454.1| PREDICTED: aspartic proteinase nepenthesin-2-like [Vitis vinifera] Length = 485 Score = 95.1 bits (235), Expect = 5e-18 Identities = 43/58 (74%), Positives = 48/58 (82%) Frame = -3 Query: 176 YSYTPMLYNPKHSYFYCVGLEAVSIGKIKIPAPASLRRVDRRGNGGMVVDSGTTFTML 3 + YT ML NPKH YFYCVGLE +++G KIP P L+RVDRRGNGGMVVDSGTTFTML Sbjct: 289 FVYTAMLDNPKHPYFYCVGLEGITVGNRKIPVPEILKRVDRRGNGGMVVDSGTTFTML 346 >ref|XP_002304273.1| predicted protein [Populus trichocarpa] gi|222841705|gb|EEE79252.1| predicted protein [Populus trichocarpa] Length = 496 Score = 92.8 bits (229), Expect = 3e-17 Identities = 42/58 (72%), Positives = 50/58 (86%) Frame = -3 Query: 176 YSYTPMLYNPKHSYFYCVGLEAVSIGKIKIPAPASLRRVDRRGNGGMVVDSGTTFTML 3 + YT ML NP+H YFYCVGLE +SIG+ KIPAP LR+VDR+G+GG+VVDSGTTFTML Sbjct: 298 FVYTSMLDNPRHPYFYCVGLEGISIGRKKIPAPDFLRKVDRKGSGGVVVDSGTTFTML 355 >ref|XP_003538731.1| PREDICTED: aspartic proteinase nepenthesin-1-like [Glycine max] Length = 417 Score = 92.4 bits (228), Expect = 3e-17 Identities = 44/60 (73%), Positives = 49/60 (81%) Frame = -3 Query: 182 VYYSYTPMLYNPKHSYFYCVGLEAVSIGKIKIPAPASLRRVDRRGNGGMVVDSGTTFTML 3 V + YT ML NPKHSYFYCVGL +S+GK I AP LRRVDRRG+GG+VVDSGTTFTML Sbjct: 218 VEFVYTSMLRNPKHSYFYCVGLTGISVGKRTILAPEMLRRVDRRGDGGVVVDSGTTFTML 277 >ref|XP_003611301.1| Aspartic proteinase nepenthesin-2 [Medicago truncatula] gi|355512636|gb|AES94259.1| Aspartic proteinase nepenthesin-2 [Medicago truncatula] Length = 481 Score = 91.7 bits (226), Expect = 6e-17 Identities = 41/60 (68%), Positives = 48/60 (80%) Frame = -3 Query: 182 VYYSYTPMLYNPKHSYFYCVGLEAVSIGKIKIPAPASLRRVDRRGNGGMVVDSGTTFTML 3 V + YT ML NPKH Y+YCVGL +S+GK +PAP L+RVD +GNGGMVVDSGTTFTML Sbjct: 280 VEFVYTSMLSNPKHPYYYCVGLAGISVGKRTVPAPEILKRVDEKGNGGMVVDSGTTFTML 339