BLASTX nr result
ID: Salvia21_contig00011207
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Salvia21_contig00011207 (812 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002265136.2| PREDICTED: uncharacterized protein LOC100246... 84 2e-15 emb|CBI39860.3| unnamed protein product [Vitis vinifera] 84 2e-15 ref|XP_002299081.1| tir-nbs resistance protein [Populus trichoca... 84 2e-15 ref|XP_004148292.1| PREDICTED: uncharacterized protein LOC101212... 78 5e-14 ref|XP_002531755.1| conserved hypothetical protein [Ricinus comm... 79 5e-14 >ref|XP_002265136.2| PREDICTED: uncharacterized protein LOC100246258 [Vitis vinifera] Length = 985 Score = 84.3 bits (207), Expect(2) = 2e-15 Identities = 39/49 (79%), Positives = 42/49 (85%) Frame = -3 Query: 216 VSQIQDWCHGSPCWKKALHSN*RVDEYVWQEVTLLKAALLEMRASLLLR 70 VSQIQDWCHGS CWKK + S+ RVDEYVWQ+VTLLKA LLE RA LLLR Sbjct: 891 VSQIQDWCHGSLCWKKKVQSSQRVDEYVWQDVTLLKATLLETRAKLLLR 939 Score = 24.6 bits (52), Expect(2) = 2e-15 Identities = 15/26 (57%), Positives = 17/26 (65%) Frame = -2 Query: 364 LLGLCVGQTWNGEEEVKKSVVSQIQD 287 LL +C N EEV+KS VSQIQD Sbjct: 875 LLKVCT----NVLEEVEKSFVSQIQD 896 >emb|CBI39860.3| unnamed protein product [Vitis vinifera] Length = 139 Score = 84.3 bits (207), Expect(2) = 2e-15 Identities = 39/49 (79%), Positives = 42/49 (85%) Frame = -3 Query: 216 VSQIQDWCHGSPCWKKALHSN*RVDEYVWQEVTLLKAALLEMRASLLLR 70 VSQIQDWCHGS CWKK + S+ RVDEYVWQ+VTLLKA LLE RA LLLR Sbjct: 45 VSQIQDWCHGSLCWKKKVQSSQRVDEYVWQDVTLLKATLLETRAKLLLR 93 Score = 24.6 bits (52), Expect(2) = 2e-15 Identities = 15/26 (57%), Positives = 17/26 (65%) Frame = -2 Query: 364 LLGLCVGQTWNGEEEVKKSVVSQIQD 287 LL +C N EEV+KS VSQIQD Sbjct: 29 LLKVCT----NVLEEVEKSFVSQIQD 50 >ref|XP_002299081.1| tir-nbs resistance protein [Populus trichocarpa] gi|222846339|gb|EEE83886.1| tir-nbs resistance protein [Populus trichocarpa] Length = 996 Score = 84.0 bits (206), Expect(2) = 2e-15 Identities = 37/49 (75%), Positives = 43/49 (87%) Frame = -3 Query: 216 VSQIQDWCHGSPCWKKALHSN*RVDEYVWQEVTLLKAALLEMRASLLLR 70 VSQIQDWCHGS CWK+ +H + RVDEY+WQ+VTLLKA+LLE RA LLLR Sbjct: 902 VSQIQDWCHGSLCWKRNIHGHQRVDEYLWQDVTLLKASLLETRAKLLLR 950 Score = 24.6 bits (52), Expect(2) = 2e-15 Identities = 15/26 (57%), Positives = 17/26 (65%) Frame = -2 Query: 364 LLGLCVGQTWNGEEEVKKSVVSQIQD 287 LL +C N EEV+KS VSQIQD Sbjct: 886 LLKVCT----NVLEEVEKSFVSQIQD 907 >ref|XP_004148292.1| PREDICTED: uncharacterized protein LOC101212498 [Cucumis sativus] gi|449525220|ref|XP_004169616.1| PREDICTED: uncharacterized LOC101212498 [Cucumis sativus] Length = 984 Score = 78.2 bits (191), Expect(2) = 5e-14 Identities = 37/49 (75%), Positives = 38/49 (77%) Frame = -3 Query: 216 VSQIQDWCHGSPCWKKALHSN*RVDEYVWQEVTLLKAALLEMRASLLLR 70 VSQIQDWC GS CWKK RVDEYVWQ+VTLLKA LLE RA LLLR Sbjct: 890 VSQIQDWCEGSLCWKKKFQGYQRVDEYVWQDVTLLKATLLETRAKLLLR 938 Score = 25.8 bits (55), Expect(2) = 5e-14 Identities = 15/26 (57%), Positives = 17/26 (65%) Frame = -2 Query: 364 LLGLCVGQTWNGEEEVKKSVVSQIQD 287 LL +C N EEV+KS VSQIQD Sbjct: 874 LLKVCT----NALEEVEKSFVSQIQD 895 >ref|XP_002531755.1| conserved hypothetical protein [Ricinus communis] gi|223528591|gb|EEF30611.1| conserved hypothetical protein [Ricinus communis] Length = 334 Score = 79.0 bits (193), Expect(2) = 5e-14 Identities = 36/49 (73%), Positives = 39/49 (79%) Frame = -3 Query: 216 VSQIQDWCHGSPCWKKALHSN*RVDEYVWQEVTLLKAALLEMRASLLLR 70 VSQIQDWCH S CWKK + RVDEY+WQ+VTLLKA LLE RA LLLR Sbjct: 240 VSQIQDWCHDSLCWKKKIQGQQRVDEYLWQDVTLLKATLLETRAKLLLR 288 Score = 25.0 bits (53), Expect(2) = 5e-14 Identities = 15/30 (50%), Positives = 19/30 (63%) Frame = -2 Query: 376 MPMVLLGLCVGQTWNGEEEVKKSVVSQIQD 287 + + LL +C N EEV+KS VSQIQD Sbjct: 220 LALELLKVCT----NVLEEVEKSFVSQIQD 245