BLASTX nr result
ID: Salvia21_contig00011151
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Salvia21_contig00011151 (575 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002284399.1| PREDICTED: DUF246 domain-containing protein ... 82 5e-14 emb|CBI19065.3| unnamed protein product [Vitis vinifera] 82 5e-14 ref|XP_003544150.1| PREDICTED: DUF246 domain-containing protein ... 74 2e-11 ref|XP_004142690.1| PREDICTED: DUF246 domain-containing protein ... 74 2e-11 ref|XP_003614789.1| Growth regulator-related protein [Medicago t... 72 5e-11 >ref|XP_002284399.1| PREDICTED: DUF246 domain-containing protein At1g04910-like [Vitis vinifera] Length = 585 Score = 82.4 bits (202), Expect = 5e-14 Identities = 38/53 (71%), Positives = 43/53 (81%) Frame = +3 Query: 6 SWDGFKDEMETMLAESDRRSIMVPRVKKSTRKGSIYLNPLPECRCLWESQNST 164 SW FK+EME+ML ESDR+ + VPR+KKS RK SIY PLPECRCL ESQNST Sbjct: 515 SWKAFKNEMESMLIESDRKGMNVPRIKKSRRKSSIYTYPLPECRCLLESQNST 567 >emb|CBI19065.3| unnamed protein product [Vitis vinifera] Length = 585 Score = 82.4 bits (202), Expect = 5e-14 Identities = 38/53 (71%), Positives = 43/53 (81%) Frame = +3 Query: 6 SWDGFKDEMETMLAESDRRSIMVPRVKKSTRKGSIYLNPLPECRCLWESQNST 164 SW FK+EME+ML ESDR+ + VPR+KKS RK SIY PLPECRCL ESQNST Sbjct: 515 SWKAFKNEMESMLIESDRKGMNVPRIKKSRRKSSIYTYPLPECRCLLESQNST 567 >ref|XP_003544150.1| PREDICTED: DUF246 domain-containing protein At1g04910-like [Glycine max] Length = 592 Score = 73.9 bits (180), Expect = 2e-11 Identities = 37/63 (58%), Positives = 44/63 (69%), Gaps = 1/63 (1%) Frame = +3 Query: 6 SWDGFKDEMETMLAESDRRSIMVPRVKKSTRKGSIYLNPLPECRCLWES-QNSTSRSDLF 182 SW FKD+ME ML ESDR+ IMVPRV+K RK S+Y PLPECRCL +S N R+ + Sbjct: 524 SWRAFKDQMEDMLTESDRKGIMVPRVRKINRKTSVYTYPLPECRCLQQSLANQIDRNLVI 583 Query: 183 L*D 191 L D Sbjct: 584 LDD 586 >ref|XP_004142690.1| PREDICTED: DUF246 domain-containing protein At1g04910-like [Cucumis sativus] gi|449519673|ref|XP_004166859.1| PREDICTED: DUF246 domain-containing protein At1g04910-like [Cucumis sativus] Length = 587 Score = 73.6 bits (179), Expect = 2e-11 Identities = 32/62 (51%), Positives = 44/62 (70%) Frame = +3 Query: 6 SWDGFKDEMETMLAESDRRSIMVPRVKKSTRKGSIYLNPLPECRCLWESQNSTSRSDLFL 185 SW FK++M ML+ESDR+ +MVPR+++ RK S+Y PLPECRCL +S N S D ++ Sbjct: 519 SWKEFKEQMGVMLSESDRKGLMVPRIRRFNRKTSVYTYPLPECRCLQKSHNINSTDDNYI 578 Query: 186 *D 191 D Sbjct: 579 LD 580 >ref|XP_003614789.1| Growth regulator-related protein [Medicago truncatula] gi|355516124|gb|AES97747.1| Growth regulator-related protein [Medicago truncatula] Length = 589 Score = 72.4 bits (176), Expect = 5e-11 Identities = 32/49 (65%), Positives = 38/49 (77%) Frame = +3 Query: 6 SWDGFKDEMETMLAESDRRSIMVPRVKKSTRKGSIYLNPLPECRCLWES 152 SW KD+M+ ML+ESDR+ IMVPRV+K RK S+Y PLPECRCL ES Sbjct: 515 SWSALKDQMDDMLSESDRKGIMVPRVRKINRKTSVYTYPLPECRCLQES 563