BLASTX nr result
ID: Salvia21_contig00010178
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Salvia21_contig00010178 (281 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004139520.1| PREDICTED: oligopeptide transporter 3-like [... 70 2e-10 ref|XP_003549274.1| PREDICTED: oligopeptide transporter 3-like [... 70 2e-10 ref|XP_003529676.1| PREDICTED: oligopeptide transporter 3-like [... 70 2e-10 ref|XP_003559475.1| PREDICTED: LOW QUALITY PROTEIN: oligopeptide... 70 2e-10 ref|XP_002463867.1| hypothetical protein SORBIDRAFT_01g007880 [S... 70 2e-10 >ref|XP_004139520.1| PREDICTED: oligopeptide transporter 3-like [Cucumis sativus] gi|449505548|ref|XP_004162504.1| PREDICTED: oligopeptide transporter 3-like [Cucumis sativus] Length = 745 Score = 70.1 bits (170), Expect = 2e-10 Identities = 28/34 (82%), Positives = 33/34 (97%) Frame = +3 Query: 60 QMVGYGWAGMLRKYLVDPVEMWWPSNVTQVSLFR 161 Q++GYGWAGMLR+YLVDPVEMWWP+N+ QVSLFR Sbjct: 172 QVLGYGWAGMLRRYLVDPVEMWWPANLAQVSLFR 205 >ref|XP_003549274.1| PREDICTED: oligopeptide transporter 3-like [Glycine max] Length = 741 Score = 70.1 bits (170), Expect = 2e-10 Identities = 28/34 (82%), Positives = 33/34 (97%) Frame = +3 Query: 60 QMVGYGWAGMLRKYLVDPVEMWWPSNVTQVSLFR 161 QM+GYGWAG+LR+YLVDPVEMWWP+N+ QVSLFR Sbjct: 167 QMMGYGWAGILRRYLVDPVEMWWPANLAQVSLFR 200 >ref|XP_003529676.1| PREDICTED: oligopeptide transporter 3-like [Glycine max] Length = 742 Score = 70.1 bits (170), Expect = 2e-10 Identities = 28/34 (82%), Positives = 33/34 (97%) Frame = +3 Query: 60 QMVGYGWAGMLRKYLVDPVEMWWPSNVTQVSLFR 161 QM+GYGWAG+LR+YLVDPVEMWWP+N+ QVSLFR Sbjct: 168 QMLGYGWAGILRRYLVDPVEMWWPANLAQVSLFR 201 >ref|XP_003559475.1| PREDICTED: LOW QUALITY PROTEIN: oligopeptide transporter 3-like, partial [Brachypodium distachyon] Length = 487 Score = 69.7 bits (169), Expect = 2e-10 Identities = 28/34 (82%), Positives = 32/34 (94%) Frame = +3 Query: 60 QMVGYGWAGMLRKYLVDPVEMWWPSNVTQVSLFR 161 Q++GYGWAGMLR+YLVDP EMWWPSN+ QVSLFR Sbjct: 171 QILGYGWAGMLRRYLVDPAEMWWPSNLAQVSLFR 204 >ref|XP_002463867.1| hypothetical protein SORBIDRAFT_01g007880 [Sorghum bicolor] gi|241917721|gb|EER90865.1| hypothetical protein SORBIDRAFT_01g007880 [Sorghum bicolor] Length = 747 Score = 69.7 bits (169), Expect = 2e-10 Identities = 28/34 (82%), Positives = 32/34 (94%) Frame = +3 Query: 60 QMVGYGWAGMLRKYLVDPVEMWWPSNVTQVSLFR 161 Q++GYGWAGMLR+YLVDP EMWWPSN+ QVSLFR Sbjct: 171 QILGYGWAGMLRRYLVDPAEMWWPSNLAQVSLFR 204