BLASTX nr result
ID: Salvia21_contig00009901
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Salvia21_contig00009901 (1632 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002457701.1| hypothetical protein SORBIDRAFT_03g011860 [S... 59 4e-06 >ref|XP_002457701.1| hypothetical protein SORBIDRAFT_03g011860 [Sorghum bicolor] gi|241929676|gb|EES02821.1| hypothetical protein SORBIDRAFT_03g011860 [Sorghum bicolor] Length = 1280 Score = 58.9 bits (141), Expect = 4e-06 Identities = 32/100 (32%), Positives = 58/100 (58%), Gaps = 9/100 (9%) Frame = -3 Query: 307 LLRDNTIIASLPTLLCQQVEVAFLNAK---PQNPNALSKVASYTGKKRAVSEYNKSLDNA 137 L+ +++++ T + + A+ + Q ++ VAS+TG+KRAV +YNKSL NA Sbjct: 225 LVMAGAVMSNVVTKMASLGQAAYAESSVVVEQTIGSIRTVASFTGEKRAVEKYNKSLKNA 284 Query: 136 YKSSVHQGLATEIVRQKLLIRIWC------LYGGRIVRQK 35 YKS V +GLAT + +++ ++C YG +++ +K Sbjct: 285 YKSGVREGLATGLGMGTVMVLLFCGYSLGIWYGAKLILEK 324