BLASTX nr result
ID: Salvia21_contig00009746
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Salvia21_contig00009746 (934 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value pdb|3S2Q|A Chain A, The Crystal Structure Of At5g51720 (At-Neet)... 81 4e-13 ref|XP_002864123.1| hypothetical protein ARALYDRAFT_495239 [Arab... 81 4e-13 ref|XP_002510894.1| conserved hypothetical protein [Ricinus comm... 81 4e-13 ref|XP_002321854.1| predicted protein [Populus trichocarpa] gi|2... 81 4e-13 ref|XP_002318867.1| predicted protein [Populus trichocarpa] gi|2... 81 4e-13 >pdb|3S2Q|A Chain A, The Crystal Structure Of At5g51720 (At-Neet) gi|388325589|pdb|3S2Q|B Chain B, The Crystal Structure Of At5g51720 (At-Neet) Length = 83 Score = 80.9 bits (198), Expect = 4e-13 Identities = 33/36 (91%), Positives = 36/36 (100%) Frame = -2 Query: 186 WCRCWRSGTFPLCDGSHMKHNKASGDNVGPLLLKKQ 79 +CRCWRSGTFPLCDGSH+KHNKA+GDNVGPLLLKKQ Sbjct: 48 YCRCWRSGTFPLCDGSHVKHNKANGDNVGPLLLKKQ 83 >ref|XP_002864123.1| hypothetical protein ARALYDRAFT_495239 [Arabidopsis lyrata subsp. lyrata] gi|297309958|gb|EFH40382.1| hypothetical protein ARALYDRAFT_495239 [Arabidopsis lyrata subsp. lyrata] Length = 109 Score = 80.9 bits (198), Expect = 4e-13 Identities = 33/36 (91%), Positives = 36/36 (100%) Frame = -2 Query: 186 WCRCWRSGTFPLCDGSHMKHNKASGDNVGPLLLKKQ 79 +CRCWRSGTFPLCDGSH+KHNKA+GDNVGPLLLKKQ Sbjct: 74 YCRCWRSGTFPLCDGSHVKHNKANGDNVGPLLLKKQ 109 >ref|XP_002510894.1| conserved hypothetical protein [Ricinus communis] gi|223550009|gb|EEF51496.1| conserved hypothetical protein [Ricinus communis] Length = 111 Score = 80.9 bits (198), Expect = 4e-13 Identities = 33/36 (91%), Positives = 36/36 (100%) Frame = -2 Query: 186 WCRCWRSGTFPLCDGSHMKHNKASGDNVGPLLLKKQ 79 +CRCWRSGTFPLCDGSH+KHNKA+GDNVGPLLLKKQ Sbjct: 74 YCRCWRSGTFPLCDGSHVKHNKATGDNVGPLLLKKQ 109 >ref|XP_002321854.1| predicted protein [Populus trichocarpa] gi|222868850|gb|EEF05981.1| predicted protein [Populus trichocarpa] Length = 168 Score = 80.9 bits (198), Expect = 4e-13 Identities = 33/36 (91%), Positives = 36/36 (100%) Frame = -2 Query: 186 WCRCWRSGTFPLCDGSHMKHNKASGDNVGPLLLKKQ 79 +CRCWRSGTFPLCDGSH+KHNKA+GDNVGPLLLKKQ Sbjct: 131 YCRCWRSGTFPLCDGSHVKHNKATGDNVGPLLLKKQ 166 >ref|XP_002318867.1| predicted protein [Populus trichocarpa] gi|222859540|gb|EEE97087.1| predicted protein [Populus trichocarpa] Length = 107 Score = 80.9 bits (198), Expect = 4e-13 Identities = 33/36 (91%), Positives = 36/36 (100%) Frame = -2 Query: 186 WCRCWRSGTFPLCDGSHMKHNKASGDNVGPLLLKKQ 79 +CRCWRSGTFPLCDGSH+KHNKA+GDNVGPLLLKKQ Sbjct: 70 YCRCWRSGTFPLCDGSHVKHNKATGDNVGPLLLKKQ 105