BLASTX nr result
ID: Salvia21_contig00009745
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Salvia21_contig00009745 (746 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002318867.1| predicted protein [Populus trichocarpa] gi|2... 69 1e-09 emb|CBI24493.3| unnamed protein product [Vitis vinifera] 65 1e-08 ref|XP_002269624.1| PREDICTED: CDGSH iron-sulfur domain-containi... 65 1e-08 ref|XP_002321854.1| predicted protein [Populus trichocarpa] gi|2... 65 2e-08 ref|NP_001147357.1| kinesin like protein [Zea mays] gi|195610490... 64 3e-08 >ref|XP_002318867.1| predicted protein [Populus trichocarpa] gi|222859540|gb|EEE97087.1| predicted protein [Populus trichocarpa] Length = 107 Score = 68.6 bits (166), Expect = 1e-09 Identities = 36/63 (57%), Positives = 48/63 (76%), Gaps = 2/63 (3%) Frame = +1 Query: 7 SSTYASLSYGGPAPSTAASQPRRRMVAVRADA--INPDIRKTEEKVVDSVLLTEIAKPVT 180 S Y+ GG P+ AA++PR +V VRA+A INP+IRKTEEKVVDSV++ E++KP+T Sbjct: 10 SFCYSKSRIGGVKPNIAAARPRS-LVVVRAEAQAINPEIRKTEEKVVDSVMVAELSKPLT 68 Query: 181 AYC 189 AYC Sbjct: 69 AYC 71 >emb|CBI24493.3| unnamed protein product [Vitis vinifera] Length = 97 Score = 65.5 bits (158), Expect(2) = 1e-08 Identities = 34/54 (62%), Positives = 41/54 (75%) Frame = +1 Query: 28 SYGGPAPSTAASQPRRRMVAVRADAINPDIRKTEEKVVDSVLLTEIAKPVTAYC 189 S+G P ++S RR V VRA+ INP+IRK EEKVVDSVL+ E+AKPVTAYC Sbjct: 12 SFGTQFP-ISSSGAARRAVVVRAETINPEIRKIEEKVVDSVLVAELAKPVTAYC 64 Score = 20.4 bits (41), Expect(2) = 1e-08 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = +3 Query: 264 PVTAYCR 284 PVTAYCR Sbjct: 59 PVTAYCR 65 >ref|XP_002269624.1| PREDICTED: CDGSH iron-sulfur domain-containing protein 2-like [Vitis vinifera] Length = 117 Score = 65.5 bits (158), Expect(2) = 1e-08 Identities = 34/54 (62%), Positives = 41/54 (75%) Frame = +1 Query: 28 SYGGPAPSTAASQPRRRMVAVRADAINPDIRKTEEKVVDSVLLTEIAKPVTAYC 189 S+G P ++S RR V VRA+ INP+IRK EEKVVDSVL+ E+AKPVTAYC Sbjct: 32 SFGTQFP-ISSSGAARRAVVVRAETINPEIRKIEEKVVDSVLVAELAKPVTAYC 84 Score = 20.4 bits (41), Expect(2) = 1e-08 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = +3 Query: 264 PVTAYCR 284 PVTAYCR Sbjct: 79 PVTAYCR 85 >ref|XP_002321854.1| predicted protein [Populus trichocarpa] gi|222868850|gb|EEF05981.1| predicted protein [Populus trichocarpa] Length = 168 Score = 64.7 bits (156), Expect = 2e-08 Identities = 35/63 (55%), Positives = 46/63 (73%), Gaps = 2/63 (3%) Frame = +1 Query: 7 SSTYASLSYGGPAPSTAASQPRRRMVAVRADA--INPDIRKTEEKVVDSVLLTEIAKPVT 180 S Y+ GG P+ AA +PR +V VRA+A INP+IRK EEKVVDSV++ E++KP+T Sbjct: 71 SFRYSKSRTGGVKPNIAAVRPRS-LVVVRAEAQSINPEIRKNEEKVVDSVVVAELSKPLT 129 Query: 181 AYC 189 AYC Sbjct: 130 AYC 132 >ref|NP_001147357.1| kinesin like protein [Zea mays] gi|195610490|gb|ACG27075.1| kinesin like protein [Zea mays] gi|223945179|gb|ACN26673.1| unknown [Zea mays] gi|414886529|tpg|DAA62543.1| TPA: kinesin like protein [Zea mays] Length = 105 Score = 63.9 bits (154), Expect = 3e-08 Identities = 37/68 (54%), Positives = 47/68 (69%), Gaps = 6/68 (8%) Frame = +1 Query: 4 FSSTYASLSYGGPAPSTAASQ---PRRRMVAVRADA---INPDIRKTEEKVVDSVLLTEI 165 F + A+ PAPS A++ PRR +VAVRA+A INP IRK E+KVVD+VL E+ Sbjct: 5 FCAAAAACRLAVPAPSPPAARAPRPRRGLVAVRAEAGGGINPAIRKEEDKVVDTVLTGEL 64 Query: 166 AKPVTAYC 189 AKP+TAYC Sbjct: 65 AKPLTAYC 72