BLASTX nr result
ID: Salvia21_contig00009727
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Salvia21_contig00009727 (738 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value sp|Q6RYA0.1|SABP2_TOBAC RecName: Full=Salicylic acid-binding pro... 95 1e-23 pdb|1XKL|A Chain A, Crystal Structure Of Salicylic Acid-Binding ... 95 3e-22 pdb|1Y7H|A Chain A, Structural And Biochemical Studies Identify ... 95 3e-22 gb|AFS35576.1| salicylic acid-binding protein 2 [Nicotiana benth... 90 3e-22 sp|Q9SE93.1|PNAE_RAUSE RecName: Full=Polyneuridine-aldehyde este... 83 1e-21 >sp|Q6RYA0.1|SABP2_TOBAC RecName: Full=Salicylic acid-binding protein 2; Short=NtSABP2; AltName: Full=Methyl salicylate esterase gi|40549303|gb|AAR87711.1| salicylic acid-binding protein 2 [Nicotiana tabacum] Length = 260 Score = 94.7 bits (234), Expect(2) = 1e-23 Identities = 45/63 (71%), Positives = 49/63 (77%) Frame = +3 Query: 177 CIVQDLELAKMLIRPSSLFREDLSKRSAFTKERYGSVKRVYAVCTEDKGIPESFQRWQIE 356 C +DL LA L+RPSSLF EDLSK FT ER+GSVKRVY VCTEDKGIPE FQRWQI+ Sbjct: 164 CSPEDLALASSLVRPSSLFMEDLSKAKYFTDERFGSVKRVYIVCTEDKGIPEEFQRWQID 223 Query: 357 TNG 365 G Sbjct: 224 NIG 226 Score = 41.2 bits (95), Expect(2) = 1e-23 Identities = 19/34 (55%), Positives = 24/34 (70%) Frame = +2 Query: 449 GVDEVKVLENADHMAMFSQPQELCQCLLEIANIY 550 GV E ++ ADHMAM +PQ+LC LLEIA+ Y Sbjct: 226 GVTEAIEIKGADHMAMLCEPQKLCASLLEIAHKY 259 >pdb|1XKL|A Chain A, Crystal Structure Of Salicylic Acid-Binding Protein 2 (Sabp2) From Nicotiana Tabacum, Nesg Target Ar2241 gi|56967125|pdb|1XKL|B Chain B, Crystal Structure Of Salicylic Acid-Binding Protein 2 (Sabp2) From Nicotiana Tabacum, Nesg Target Ar2241 gi|56967126|pdb|1XKL|C Chain C, Crystal Structure Of Salicylic Acid-Binding Protein 2 (Sabp2) From Nicotiana Tabacum, Nesg Target Ar2241 gi|56967127|pdb|1XKL|D Chain D, Crystal Structure Of Salicylic Acid-Binding Protein 2 (Sabp2) From Nicotiana Tabacum, Nesg Target Ar2241 Length = 273 Score = 94.7 bits (234), Expect(2) = 3e-22 Identities = 45/63 (71%), Positives = 49/63 (77%) Frame = +3 Query: 177 CIVQDLELAKMLIRPSSLFREDLSKRSAFTKERYGSVKRVYAVCTEDKGIPESFQRWQIE 356 C +DL LA L+RPSSLF EDLSK FT ER+GSVKRVY VCTEDKGIPE FQRWQI+ Sbjct: 164 CSPEDLALASSLVRPSSLFXEDLSKAKYFTDERFGSVKRVYIVCTEDKGIPEEFQRWQID 223 Query: 357 TNG 365 G Sbjct: 224 NIG 226 Score = 36.6 bits (83), Expect(2) = 3e-22 Identities = 17/34 (50%), Positives = 22/34 (64%) Frame = +2 Query: 449 GVDEVKVLENADHMAMFSQPQELCQCLLEIANIY 550 GV E ++ ADH A +PQ+LC LLEIA+ Y Sbjct: 226 GVTEAIEIKGADHXAXLCEPQKLCASLLEIAHKY 259 >pdb|1Y7H|A Chain A, Structural And Biochemical Studies Identify Tobacco Sabp2 As A Methylsalicylate Esterase And Further Implicate It In Plant Innate Immunity, Northeast Structural Genomics Target Ar2241 gi|61679533|pdb|1Y7H|B Chain B, Structural And Biochemical Studies Identify Tobacco Sabp2 As A Methylsalicylate Esterase And Further Implicate It In Plant Innate Immunity, Northeast Structural Genomics Target Ar2241 gi|61679534|pdb|1Y7H|C Chain C, Structural And Biochemical Studies Identify Tobacco Sabp2 As A Methylsalicylate Esterase And Further Implicate It In Plant Innate Immunity, Northeast Structural Genomics Target Ar2241 gi|61679535|pdb|1Y7H|D Chain D, Structural And Biochemical Studies Identify Tobacco Sabp2 As A Methylsalicylate Esterase And Further Implicate It In Plant Innate Immunity, Northeast Structural Genomics Target Ar2241 gi|61679536|pdb|1Y7H|E Chain E, Structural And Biochemical Studies Identify Tobacco Sabp2 As A Methylsalicylate Esterase And Further Implicate It In Plant Innate Immunity, Northeast Structural Genomics Target Ar2241 gi|61679537|pdb|1Y7H|F Chain F, Structural And Biochemical Studies Identify Tobacco Sabp2 As A Methylsalicylate Esterase And Further Implicate It In Plant Innate Immunity, Northeast Structural Genomics Target Ar2241 gi|61679538|pdb|1Y7H|G Chain G, Structural And Biochemical Studies Identify Tobacco Sabp2 As A Methylsalicylate Esterase And Further Implicate It In Plant Innate Immunity, Northeast Structural Genomics Target Ar2241 gi|61679539|pdb|1Y7H|H Chain H, Structural And Biochemical Studies Identify Tobacco Sabp2 As A Methylsalicylate Esterase And Further Implicate It In Plant Innate Immunity, Northeast Structural Genomics Target Ar2241 gi|61679593|pdb|1Y7I|A Chain A, Structural And Biochemical Studies Identify Tobacco Sabp2 As A Methylsalicylate Esterase And Further Implicate It In Plant Innate Immunity, Northeast Structural Genomics Target Ar2241 gi|61679594|pdb|1Y7I|B Chain B, Structural And Biochemical Studies Identify Tobacco Sabp2 As A Methylsalicylate Esterase And Further Implicate It In Plant Innate Immunity, Northeast Structural Genomics Target Ar2241 Length = 268 Score = 94.7 bits (234), Expect(2) = 3e-22 Identities = 45/63 (71%), Positives = 49/63 (77%) Frame = +3 Query: 177 CIVQDLELAKMLIRPSSLFREDLSKRSAFTKERYGSVKRVYAVCTEDKGIPESFQRWQIE 356 C +DL LA L+RPSSLF EDLSK FT ER+GSVKRVY VCTEDKGIPE FQRWQI+ Sbjct: 164 CSPEDLALASSLVRPSSLFXEDLSKAKYFTDERFGSVKRVYIVCTEDKGIPEEFQRWQID 223 Query: 357 TNG 365 G Sbjct: 224 NIG 226 Score = 36.6 bits (83), Expect(2) = 3e-22 Identities = 17/34 (50%), Positives = 22/34 (64%) Frame = +2 Query: 449 GVDEVKVLENADHMAMFSQPQELCQCLLEIANIY 550 GV E ++ ADH A +PQ+LC LLEIA+ Y Sbjct: 226 GVTEAIEIKGADHXAXLCEPQKLCASLLEIAHKY 259 >gb|AFS35576.1| salicylic acid-binding protein 2 [Nicotiana benthamiana] Length = 260 Score = 89.7 bits (221), Expect(2) = 3e-22 Identities = 42/63 (66%), Positives = 48/63 (76%) Frame = +3 Query: 177 CIVQDLELAKMLIRPSSLFREDLSKRSAFTKERYGSVKRVYAVCTEDKGIPESFQRWQIE 356 C ++DL LA L+RPSSLF EDL+K FT E +GSVKRVY VCTEDK IPE FQRWQI+ Sbjct: 164 CSLEDLALASSLVRPSSLFMEDLAKAKYFTDEGFGSVKRVYIVCTEDKAIPEEFQRWQID 223 Query: 357 TNG 365 G Sbjct: 224 NIG 226 Score = 41.6 bits (96), Expect(2) = 3e-22 Identities = 19/34 (55%), Positives = 24/34 (70%) Frame = +2 Query: 449 GVDEVKVLENADHMAMFSQPQELCQCLLEIANIY 550 GV E ++ ADHMAM +PQ+LC LLEIA+ Y Sbjct: 226 GVTEAIEIKGADHMAMLCEPQKLCAALLEIAHKY 259 >sp|Q9SE93.1|PNAE_RAUSE RecName: Full=Polyneuridine-aldehyde esterase; AltName: Full=Polyneuridine aldehyde esterase; Flags: Precursor gi|6651393|gb|AAF22288.1|AF178576_1 polyneuridine aldehyde esterase [Rauvolfia serpentina] Length = 264 Score = 82.8 bits (203), Expect(2) = 1e-21 Identities = 38/63 (60%), Positives = 45/63 (71%) Frame = +3 Query: 177 CIVQDLELAKMLIRPSSLFREDLSKRSAFTKERYGSVKRVYAVCTEDKGIPESFQRWQIE 356 C V+DLELAKML RP SLF +DL+K F+ ERYGSVKR Y C EDK P FQ+W +E Sbjct: 170 CSVEDLELAKMLTRPGSLFFQDLAKAKKFSTERYGSVKRAYIFCNEDKSFPVEFQKWFVE 229 Query: 357 TNG 365 + G Sbjct: 230 SVG 232 Score = 46.6 bits (109), Expect(2) = 1e-21 Identities = 18/32 (56%), Positives = 27/32 (84%) Frame = +2 Query: 449 GVDEVKVLENADHMAMFSQPQELCQCLLEIAN 544 G D+VK ++ ADHM M SQP+E+C+CLL+I++ Sbjct: 232 GADKVKEIKEADHMGMLSQPREVCKCLLDISD 263