BLASTX nr result
ID: Salvia21_contig00009241
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Salvia21_contig00009241 (426 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002514193.1| Protein-tyrosine phosphatase mitochondrial 1... 78 7e-13 ref|XP_002283341.2| PREDICTED: protein-tyrosine phosphatase mito... 77 1e-12 emb|CAN61438.1| hypothetical protein VITISV_033771 [Vitis vinifera] 77 1e-12 ref|XP_003530527.1| PREDICTED: protein-tyrosine phosphatase mito... 76 2e-12 ref|XP_002862392.1| predicted protein [Arabidopsis lyrata subsp.... 76 2e-12 >ref|XP_002514193.1| Protein-tyrosine phosphatase mitochondrial 1, mitochondrial precursor, putative [Ricinus communis] gi|223546649|gb|EEF48147.1| Protein-tyrosine phosphatase mitochondrial 1, mitochondrial precursor, putative [Ricinus communis] Length = 284 Score = 78.2 bits (191), Expect = 7e-13 Identities = 36/40 (90%), Positives = 38/40 (95%) Frame = -1 Query: 426 VLLGAVPFPTDVPRLKALGVGGVVTLNEPYETLVPSSLYH 307 +LLGAVPFP DVPRLK LGVGGV+TLNEPYETLVPSSLYH Sbjct: 70 LLLGAVPFPKDVPRLKQLGVGGVITLNEPYETLVPSSLYH 109 >ref|XP_002283341.2| PREDICTED: protein-tyrosine phosphatase mitochondrial 1-like isoform 1 [Vitis vinifera] gi|297738731|emb|CBI27976.3| unnamed protein product [Vitis vinifera] Length = 280 Score = 77.0 bits (188), Expect = 1e-12 Identities = 35/40 (87%), Positives = 38/40 (95%) Frame = -1 Query: 426 VLLGAVPFPTDVPRLKALGVGGVVTLNEPYETLVPSSLYH 307 +LLGAVPFP DVPRLK LGVGGV+TLNEPYETLVP+SLYH Sbjct: 67 LLLGAVPFPKDVPRLKQLGVGGVITLNEPYETLVPTSLYH 106 >emb|CAN61438.1| hypothetical protein VITISV_033771 [Vitis vinifera] Length = 271 Score = 77.0 bits (188), Expect = 1e-12 Identities = 35/40 (87%), Positives = 38/40 (95%) Frame = -1 Query: 426 VLLGAVPFPTDVPRLKALGVGGVVTLNEPYETLVPSSLYH 307 +LLGAVPFP DVPRLK LGVGGV+TLNEPYETLVP+SLYH Sbjct: 39 LLLGAVPFPKDVPRLKQLGVGGVITLNEPYETLVPTSLYH 78 >ref|XP_003530527.1| PREDICTED: protein-tyrosine phosphatase mitochondrial 1-like [Glycine max] Length = 282 Score = 76.3 bits (186), Expect = 2e-12 Identities = 35/40 (87%), Positives = 37/40 (92%) Frame = -1 Query: 426 VLLGAVPFPTDVPRLKALGVGGVVTLNEPYETLVPSSLYH 307 +LLGAVPFP DVP LK LGVGGV+TLNEPYETLVPSSLYH Sbjct: 68 LLLGAVPFPKDVPHLKKLGVGGVITLNEPYETLVPSSLYH 107 >ref|XP_002862392.1| predicted protein [Arabidopsis lyrata subsp. lyrata] gi|297307863|gb|EFH38650.1| predicted protein [Arabidopsis lyrata subsp. lyrata] Length = 128 Score = 76.3 bits (186), Expect = 2e-12 Identities = 36/44 (81%), Positives = 40/44 (90%) Frame = -1 Query: 426 VLLGAVPFPTDVPRLKALGVGGVVTLNEPYETLVPSSLYHVSLF 295 +LLGAVPFP+DVP+LK LGV GV+TLNEPYETLVPSSLY V LF Sbjct: 82 ILLGAVPFPSDVPQLKELGVCGVITLNEPYETLVPSSLYKVCLF 125