BLASTX nr result
ID: Salvia21_contig00009108
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Salvia21_contig00009108 (276 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_001234202.1| NRC1 [Solanum lycopersicum] gi|83630761|gb|A... 66 3e-09 dbj|BAD15107.1| hypothetical protein [Nicotiana tabacum] 65 7e-09 >ref|NP_001234202.1| NRC1 [Solanum lycopersicum] gi|83630761|gb|ABC26878.1| NRC1 [Solanum lycopersicum] Length = 888 Score = 65.9 bits (159), Expect = 3e-09 Identities = 32/86 (37%), Positives = 47/86 (54%) Frame = -3 Query: 262 EPPVSEVKDSHRLCFRSNLSKFLQESPCGPHVRSFLCFYERPVELEPQYITVIPDGFRKL 83 E V EV RLC S++ +F+ + P G HVRSFLCF ++ P I F L Sbjct: 506 EQSVREVSTHRRLCIHSSVVEFISKKPSGEHVRSFLCFSPEKIDTPPTVSANISKAFPLL 565 Query: 82 RILESKCIIFNQFPAKITKLIHLRYL 5 R+ +++ I N+F + +L HLRY+ Sbjct: 566 RVFDTESIKINRFCKEFFQLYHLRYI 591 >dbj|BAD15107.1| hypothetical protein [Nicotiana tabacum] Length = 364 Score = 64.7 bits (156), Expect = 7e-09 Identities = 32/85 (37%), Positives = 48/85 (56%) Frame = -3 Query: 259 PPVSEVKDSHRLCFRSNLSKFLQESPCGPHVRSFLCFYERPVELEPQYITVIPDGFRKLR 80 P E+ RLC S++ +F+ P G HVRSFL F + +E+ I IP GF LR Sbjct: 47 PGKRELATYRRLCIHSSVLEFISTKPSGEHVRSFLSFSLKKIEMPSVDIPTIPKGFPLLR 106 Query: 79 ILESKCIIFNQFPAKITKLIHLRYL 5 + + + I F++F + +L HLRY+ Sbjct: 107 VFDVESINFSRFSKEFFRLYHLRYI 131