BLASTX nr result
ID: Salvia21_contig00008681
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Salvia21_contig00008681 (207 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ACQ44221.1| putative inositol-3-phosphate synthase isozyme 3 ... 76 3e-12 gb|ABC55420.1| myo-inositol-1-phosphate synthase [Glycine max] 75 7e-12 gb|AAK72098.1| myo-inositol-1-phosphate synthase [Glycine max] g... 75 7e-12 gb|AFI61895.1| D-myo-inositol 3-phosphate synthase, partial [Gly... 75 7e-12 gb|AFI61890.1| D-myo-inositol 3-phosphate synthase, partial [Gly... 75 7e-12 >gb|ACQ44221.1| putative inositol-3-phosphate synthase isozyme 3 [Arabis alpina] Length = 510 Score = 75.9 bits (185), Expect = 3e-12 Identities = 37/40 (92%), Positives = 39/40 (97%) Frame = +1 Query: 1 KSTIVMHNTCEDSLLAAPIILDLVLLAELTTRIQFKAQNE 120 K+TIVMHNTCEDSLLAAPIILDLVLLAELTTRIQFK +NE Sbjct: 411 KNTIVMHNTCEDSLLAAPIILDLVLLAELTTRIQFKGENE 450 >gb|ABC55420.1| myo-inositol-1-phosphate synthase [Glycine max] Length = 510 Score = 74.7 bits (182), Expect = 7e-12 Identities = 36/40 (90%), Positives = 40/40 (100%) Frame = +1 Query: 1 KSTIVMHNTCEDSLLAAPIILDLVLLAELTTRIQFKAQNE 120 K+TIV+HNTCEDSLLAAPIILDLVLLAEL+TRIQFKA+NE Sbjct: 411 KNTIVLHNTCEDSLLAAPIILDLVLLAELSTRIQFKAENE 450 >gb|AAK72098.1| myo-inositol-1-phosphate synthase [Glycine max] gi|38679419|gb|AAR26531.1| myo-inositol-3-phosphate synthase [Glycine max] gi|84311231|gb|ABC55418.1| myo-inositol-1-phosphate synthase [Glycine max] gi|84311233|gb|ABC55419.1| myo-inositol-1-phosphate synthase [Glycine max] gi|255928640|gb|ACU42195.1| myo-inositol-1-phosphate synthase [Glycine max] gi|299772618|gb|ADJ38521.1| myo-inositol-1-phosphate synthase [Glycine max] gi|397310737|gb|AFO38382.1| putative myo-inositol-1-phosphate synthase [Glycine max] Length = 510 Score = 74.7 bits (182), Expect = 7e-12 Identities = 36/40 (90%), Positives = 40/40 (100%) Frame = +1 Query: 1 KSTIVMHNTCEDSLLAAPIILDLVLLAELTTRIQFKAQNE 120 KSTIV+HNTCEDSLLAAPIILDLVLLAEL+TRI+FKA+NE Sbjct: 411 KSTIVLHNTCEDSLLAAPIILDLVLLAELSTRIEFKAENE 450 >gb|AFI61895.1| D-myo-inositol 3-phosphate synthase, partial [Glycine soja] Length = 169 Score = 74.7 bits (182), Expect = 7e-12 Identities = 36/40 (90%), Positives = 40/40 (100%) Frame = +1 Query: 1 KSTIVMHNTCEDSLLAAPIILDLVLLAELTTRIQFKAQNE 120 KSTIV+HNTCEDSLLAAPIILDLVLLAEL+TRI+FKA+NE Sbjct: 73 KSTIVLHNTCEDSLLAAPIILDLVLLAELSTRIEFKAENE 112 >gb|AFI61890.1| D-myo-inositol 3-phosphate synthase, partial [Glycine soja] Length = 169 Score = 74.7 bits (182), Expect = 7e-12 Identities = 36/40 (90%), Positives = 40/40 (100%) Frame = +1 Query: 1 KSTIVMHNTCEDSLLAAPIILDLVLLAELTTRIQFKAQNE 120 KSTIV+HNTCEDSLLAAPIILDLVLLAEL+TRI+FKA+NE Sbjct: 73 KSTIVLHNTCEDSLLAAPIILDLVLLAELSTRIEFKAENE 112