BLASTX nr result
ID: Salvia21_contig00008600
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Salvia21_contig00008600 (452 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_001237309.1| uncharacterized protein LOC100527014 [Glycin... 55 5e-06 >ref|NP_001237309.1| uncharacterized protein LOC100527014 [Glycine max] gi|255631370|gb|ACU16052.1| unknown [Glycine max] Length = 159 Score = 55.5 bits (132), Expect = 5e-06 Identities = 29/47 (61%), Positives = 33/47 (70%) Frame = -3 Query: 147 SAAVSQPEISIAFASGFFTSALGTVTVSTPFSILAFT*STLVFSGRR 7 S V QP IS+ F SGF + LGT+TVSTPFSI AFT STL SG + Sbjct: 6 SIEVIQPLISMVFTSGFLSGTLGTITVSTPFSIEAFTSSTLASSGNQ 52