BLASTX nr result
ID: Salvia21_contig00008428
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Salvia21_contig00008428 (294 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002325907.1| thioredoxin f [Populus trichocarpa] gi|11848... 144 1e-32 ref|NP_186922.1| thioredoxin F1 [Arabidopsis thaliana] gi|277352... 142 4e-32 ref|XP_003624192.1| Thioredoxin [Medicago truncatula] gi|3554992... 142 4e-32 gb|ACJ83989.1| unknown [Medicago truncatula] gi|388514077|gb|AFK... 142 4e-32 gb|ADQ53451.1| plastid thioredoxin F precursor [Nicotiana tabacum] 140 8e-32 >ref|XP_002325907.1| thioredoxin f [Populus trichocarpa] gi|118488397|gb|ABK96015.1| unknown [Populus trichocarpa] gi|222862782|gb|EEF00289.1| thioredoxin f [Populus trichocarpa] Length = 188 Score = 144 bits (362), Expect = 1e-32 Identities = 65/78 (83%), Positives = 74/78 (94%) Frame = +3 Query: 3 MYTQWCGPCKVIAPKYQQLSEKYDDVVFLKLDCNDENRPLAKELGIKVVPTFKILKDSKI 182 MYTQWCGPCK+IAPKY++LS+KYDDVVFLKLDCN EN+PLAKELGIKVVPTFKILK KI Sbjct: 106 MYTQWCGPCKLIAPKYKELSQKYDDVVFLKLDCNQENKPLAKELGIKVVPTFKILKQGKI 165 Query: 183 VKEVTGAKIDNLILAIDA 236 VKEVTGAK DNL++AI++ Sbjct: 166 VKEVTGAKFDNLVIAIES 183 >ref|NP_186922.1| thioredoxin F1 [Arabidopsis thaliana] gi|27735269|sp|Q9XFH8.2|TRXF1_ARATH RecName: Full=Thioredoxin F1, chloroplastic; Short=AtTrxf1; AltName: Full=Thioredoxin F2; Short=AtTrxf2; Flags: Precursor gi|6728989|gb|AAF26987.1|AC018363_32 thioredoxin f1 [Arabidopsis thaliana] gi|17529210|gb|AAL38832.1| putative thioredoxin f1 protein [Arabidopsis thaliana] gi|20466041|gb|AAM20355.1| putative thioredoxin f1 protein [Arabidopsis thaliana] gi|21537004|gb|AAM61345.1| thioredoxin f1 [Arabidopsis thaliana] gi|332640331|gb|AEE73852.1| thioredoxin F1 [Arabidopsis thaliana] Length = 178 Score = 142 bits (357), Expect = 4e-32 Identities = 65/77 (84%), Positives = 73/77 (94%) Frame = +3 Query: 3 MYTQWCGPCKVIAPKYQQLSEKYDDVVFLKLDCNDENRPLAKELGIKVVPTFKILKDSKI 182 MYTQWCGPCKVIAPKY+ LSEKYDDVVFLKLDCN +NRPLAKELGI+VVPTFKILKD+K+ Sbjct: 94 MYTQWCGPCKVIAPKYKALSEKYDDVVFLKLDCNPDNRPLAKELGIRVVPTFKILKDNKV 153 Query: 183 VKEVTGAKIDNLILAID 233 VKEVTGAK D+L+ AI+ Sbjct: 154 VKEVTGAKYDDLVAAIE 170 >ref|XP_003624192.1| Thioredoxin [Medicago truncatula] gi|355499207|gb|AES80410.1| Thioredoxin [Medicago truncatula] Length = 182 Score = 142 bits (357), Expect = 4e-32 Identities = 66/77 (85%), Positives = 73/77 (94%) Frame = +3 Query: 3 MYTQWCGPCKVIAPKYQQLSEKYDDVVFLKLDCNDENRPLAKELGIKVVPTFKILKDSKI 182 MYTQWCGPCKVIAPKY++L+EKY DVVFLKLDCN +N+PLAKELGIKVVPTFKILKDSKI Sbjct: 101 MYTQWCGPCKVIAPKYKELAEKYLDVVFLKLDCNQDNKPLAKELGIKVVPTFKILKDSKI 160 Query: 183 VKEVTGAKIDNLILAID 233 VKEVTGAK D+L+ AID Sbjct: 161 VKEVTGAKYDDLVFAID 177 >gb|ACJ83989.1| unknown [Medicago truncatula] gi|388514077|gb|AFK45100.1| unknown [Medicago truncatula] Length = 186 Score = 142 bits (357), Expect = 4e-32 Identities = 66/77 (85%), Positives = 73/77 (94%) Frame = +3 Query: 3 MYTQWCGPCKVIAPKYQQLSEKYDDVVFLKLDCNDENRPLAKELGIKVVPTFKILKDSKI 182 MYTQWCGPCKVIAPKY++L+EKY DVVFLKLDCN +N+PLAKELGIKVVPTFKILKDSKI Sbjct: 105 MYTQWCGPCKVIAPKYKELAEKYLDVVFLKLDCNQDNKPLAKELGIKVVPTFKILKDSKI 164 Query: 183 VKEVTGAKIDNLILAID 233 VKEVTGAK D+L+ AID Sbjct: 165 VKEVTGAKYDDLVFAID 181 >gb|ADQ53451.1| plastid thioredoxin F precursor [Nicotiana tabacum] Length = 175 Score = 140 bits (354), Expect = 8e-32 Identities = 64/77 (83%), Positives = 74/77 (96%) Frame = +3 Query: 3 MYTQWCGPCKVIAPKYQQLSEKYDDVVFLKLDCNDENRPLAKELGIKVVPTFKILKDSKI 182 MYTQWCGPCKVIAPK+Q+LS+ Y+DVVFLKLDCN +NRPLAKELGIKVVPTFKILK++K+ Sbjct: 94 MYTQWCGPCKVIAPKFQELSKNYNDVVFLKLDCNQDNRPLAKELGIKVVPTFKILKNNKV 153 Query: 183 VKEVTGAKIDNLILAID 233 VKEVTGAK+DNLI AI+ Sbjct: 154 VKEVTGAKLDNLIAAIE 170