BLASTX nr result
ID: Salvia21_contig00008244
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Salvia21_contig00008244 (459 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AEX00365.1| IAA26 [Solanum lycopersicum] 61 1e-07 ref|XP_003546582.1| PREDICTED: auxin-responsive protein IAA26-li... 60 2e-07 ref|XP_003543621.1| PREDICTED: auxin-responsive protein IAA26-li... 60 2e-07 ref|XP_003530078.1| PREDICTED: auxin-responsive protein IAA26-li... 59 4e-07 ref|NP_001236774.1| uncharacterized protein LOC100305794 [Glycin... 59 4e-07 >gb|AEX00365.1| IAA26 [Solanum lycopersicum] Length = 287 Score = 60.8 bits (146), Expect = 1e-07 Identities = 29/33 (87%), Positives = 30/33 (90%) Frame = +3 Query: 3 VGDVPWHMFVSTVKRLRVLKSSELPTLSRGRKQ 101 VGDVPWHMFVSTVKRLRVLKSSEL TL+R KQ Sbjct: 253 VGDVPWHMFVSTVKRLRVLKSSELSTLTRATKQ 285 >ref|XP_003546582.1| PREDICTED: auxin-responsive protein IAA26-like [Glycine max] Length = 320 Score = 60.1 bits (144), Expect = 2e-07 Identities = 28/39 (71%), Positives = 32/39 (82%) Frame = +3 Query: 3 VGDVPWHMFVSTVKRLRVLKSSELPTLSRGRKQGKLSIN 119 VGDVPWHMFVSTVKRLRVLKSSEL + G KQ K+ ++ Sbjct: 278 VGDVPWHMFVSTVKRLRVLKSSELSAFTLGSKQDKIPLD 316 >ref|XP_003543621.1| PREDICTED: auxin-responsive protein IAA26-like [Glycine max] Length = 346 Score = 60.1 bits (144), Expect = 2e-07 Identities = 28/39 (71%), Positives = 32/39 (82%) Frame = +3 Query: 3 VGDVPWHMFVSTVKRLRVLKSSELPTLSRGRKQGKLSIN 119 VGDVPWHMFVSTVKRLRVLKSSEL + G KQ K+ ++ Sbjct: 304 VGDVPWHMFVSTVKRLRVLKSSELSAFTLGSKQDKIPLD 342 >ref|XP_003530078.1| PREDICTED: auxin-responsive protein IAA26-like [Glycine max] Length = 219 Score = 58.9 bits (141), Expect = 4e-07 Identities = 27/33 (81%), Positives = 29/33 (87%) Frame = +3 Query: 3 VGDVPWHMFVSTVKRLRVLKSSELPTLSRGRKQ 101 VGDVPWHMFVSTVKRLRVLKSS+LP + G KQ Sbjct: 186 VGDVPWHMFVSTVKRLRVLKSSDLPAFTLGSKQ 218 >ref|NP_001236774.1| uncharacterized protein LOC100305794 [Glycine max] gi|255626619|gb|ACU13654.1| unknown [Glycine max] Length = 217 Score = 58.9 bits (141), Expect = 4e-07 Identities = 27/33 (81%), Positives = 29/33 (87%) Frame = +3 Query: 3 VGDVPWHMFVSTVKRLRVLKSSELPTLSRGRKQ 101 VGDVPWHMFVSTVKRLRVLKSS+LP + G KQ Sbjct: 184 VGDVPWHMFVSTVKRLRVLKSSDLPAFTLGSKQ 216