BLASTX nr result
ID: Salvia21_contig00007611
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Salvia21_contig00007611 (310 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004135722.1| PREDICTED: reticuline oxidase-like protein-l... 58 7e-07 >ref|XP_004135722.1| PREDICTED: reticuline oxidase-like protein-like [Cucumis sativus] Length = 543 Score = 58.2 bits (139), Expect = 7e-07 Identities = 27/52 (51%), Positives = 34/52 (65%) Frame = +1 Query: 154 FLECLSHESMNNTYYDNDVHPTNSASFASVLEFSIRNLRFASESTPKPQVII 309 FL CLSH S N + ++ + S++SVL FSI NLRF S TPKPQVI+ Sbjct: 29 FLHCLSHHSPNTSSISKIIYTPTNPSYSSVLNFSIHNLRFTSPKTPKPQVIV 80