BLASTX nr result
ID: Salvia21_contig00006422
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Salvia21_contig00006422 (220 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AFK36036.1| unknown [Medicago truncatula] 70 1e-10 ref|XP_003539691.1| PREDICTED: probable histone H2B.1-like isofo... 70 1e-10 ref|XP_003556299.1| PREDICTED: probable histone H2B.1-like [Glyc... 70 1e-10 ref|XP_003538012.1| PREDICTED: probable histone H2B.1-like [Glyc... 70 1e-10 ref|XP_003539693.1| PREDICTED: probable histone H2B.1-like [Glyc... 70 1e-10 >gb|AFK36036.1| unknown [Medicago truncatula] Length = 137 Score = 70.5 bits (171), Expect = 1e-10 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -1 Query: 103 RNKKSVETYKIYIFKVLKQVHPDIGISSKAMGIM 2 RNKKSVETYKIYIFKVLKQVHPDIGISSKAMGIM Sbjct: 42 RNKKSVETYKIYIFKVLKQVHPDIGISSKAMGIM 75 >ref|XP_003539691.1| PREDICTED: probable histone H2B.1-like isoform 1 [Glycine max] gi|356542475|ref|XP_003539692.1| PREDICTED: probable histone H2B.1-like isoform 2 [Glycine max] Length = 149 Score = 70.5 bits (171), Expect = 1e-10 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -1 Query: 103 RNKKSVETYKIYIFKVLKQVHPDIGISSKAMGIM 2 RNKKSVETYKIYIFKVLKQVHPDIGISSKAMGIM Sbjct: 54 RNKKSVETYKIYIFKVLKQVHPDIGISSKAMGIM 87 >ref|XP_003556299.1| PREDICTED: probable histone H2B.1-like [Glycine max] Length = 136 Score = 70.5 bits (171), Expect = 1e-10 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -1 Query: 103 RNKKSVETYKIYIFKVLKQVHPDIGISSKAMGIM 2 RNKKSVETYKIYIFKVLKQVHPDIGISSKAMGIM Sbjct: 42 RNKKSVETYKIYIFKVLKQVHPDIGISSKAMGIM 75 >ref|XP_003538012.1| PREDICTED: probable histone H2B.1-like [Glycine max] Length = 143 Score = 70.5 bits (171), Expect = 1e-10 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -1 Query: 103 RNKKSVETYKIYIFKVLKQVHPDIGISSKAMGIM 2 RNKKSVETYKIYIFKVLKQVHPDIGISSKAMGIM Sbjct: 48 RNKKSVETYKIYIFKVLKQVHPDIGISSKAMGIM 81 >ref|XP_003539693.1| PREDICTED: probable histone H2B.1-like [Glycine max] gi|356542483|ref|XP_003539696.1| PREDICTED: probable histone H2B.1-like [Glycine max] Length = 149 Score = 70.5 bits (171), Expect = 1e-10 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -1 Query: 103 RNKKSVETYKIYIFKVLKQVHPDIGISSKAMGIM 2 RNKKSVETYKIYIFKVLKQVHPDIGISSKAMGIM Sbjct: 54 RNKKSVETYKIYIFKVLKQVHPDIGISSKAMGIM 87