BLASTX nr result
ID: Salvia21_contig00005876
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Salvia21_contig00005876 (383 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003599303.1| Malonyl CoA-acyl carrier protein transacylas... 90 2e-16 ref|XP_002516359.1| Malonyl-CoA : ACP Acyltransferase (MCAAT) [R... 90 2e-16 ref|NP_001238312.1| malonyltransferase [Glycine max] gi|82618886... 88 6e-16 gb|ACF17665.1| putative acyl-carrier-protein S-malonyltransferas... 87 1e-15 gb|AFK38673.1| unknown [Lotus japonicus] 86 2e-15 >ref|XP_003599303.1| Malonyl CoA-acyl carrier protein transacylase [Medicago truncatula] gi|355488351|gb|AES69554.1| Malonyl CoA-acyl carrier protein transacylase [Medicago truncatula] Length = 359 Score = 90.1 bits (222), Expect = 2e-16 Identities = 42/45 (93%), Positives = 45/45 (100%) Frame = +3 Query: 3 PVQWETTVKTLLSRGLKKGYELGPGKVIAGIVKRMDRGADIENIG 137 PVQWETTVKTLLS+GLKKGYELGPGKVIAGIVKRMD+GA+IENIG Sbjct: 314 PVQWETTVKTLLSKGLKKGYELGPGKVIAGIVKRMDKGAEIENIG 358 >ref|XP_002516359.1| Malonyl-CoA : ACP Acyltransferase (MCAAT) [Ricinus communis] gi|223544525|gb|EEF46043.1| Malonyl-CoA : ACP Acyltransferase (MCAAT) [Ricinus communis] Length = 400 Score = 90.1 bits (222), Expect = 2e-16 Identities = 41/45 (91%), Positives = 45/45 (100%) Frame = +3 Query: 3 PVQWETTVKTLLSRGLKKGYELGPGKVIAGIVKRMDRGADIENIG 137 PVQWETTVKTLL++GLKKGYELGPGKVIAGIVKRMD+GADIEN+G Sbjct: 355 PVQWETTVKTLLTKGLKKGYELGPGKVIAGIVKRMDKGADIENVG 399 >ref|NP_001238312.1| malonyltransferase [Glycine max] gi|82618886|gb|ABB85235.1| malonyltransferase [Glycine max] Length = 344 Score = 88.2 bits (217), Expect = 6e-16 Identities = 41/45 (91%), Positives = 44/45 (97%) Frame = +3 Query: 3 PVQWETTVKTLLSRGLKKGYELGPGKVIAGIVKRMDRGADIENIG 137 PVQWETTVKTLL++GLKK YELGPGKVIAGIVKRMD+GADIENIG Sbjct: 299 PVQWETTVKTLLTKGLKKSYELGPGKVIAGIVKRMDKGADIENIG 343 >gb|ACF17665.1| putative acyl-carrier-protein S-malonyltransferase/ transferase [Capsicum annuum] Length = 384 Score = 87.4 bits (215), Expect = 1e-15 Identities = 40/45 (88%), Positives = 44/45 (97%) Frame = +3 Query: 3 PVQWETTVKTLLSRGLKKGYELGPGKVIAGIVKRMDRGADIENIG 137 PVQWETT+KTLL++GLKK YELGPGKVIAGIVKRMDRGA+IENIG Sbjct: 339 PVQWETTIKTLLTKGLKKSYELGPGKVIAGIVKRMDRGAEIENIG 383 >gb|AFK38673.1| unknown [Lotus japonicus] Length = 134 Score = 86.3 bits (212), Expect = 2e-15 Identities = 40/45 (88%), Positives = 44/45 (97%) Frame = +3 Query: 3 PVQWETTVKTLLSRGLKKGYELGPGKVIAGIVKRMDRGADIENIG 137 PVQWETTVKTLLS+GLKKGYELGPGKVIAGIVKR+D+ A+IENIG Sbjct: 89 PVQWETTVKTLLSKGLKKGYELGPGKVIAGIVKRVDKSAEIENIG 133