BLASTX nr result
ID: Salvia21_contig00005321
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Salvia21_contig00005321 (356 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value sp|Q9AT34.3|RS15A_DAUCA RecName: Full=40S ribosomal protein S15a... 100 2e-19 gb|ACF06470.1| cytoplasmic ribosomal protein S15a [Elaeis guinee... 100 2e-19 gb|AEO34861.1| hypothetical protein [Amblyomma maculatum] 99 5e-19 emb|CBI31713.3| unnamed protein product [Vitis vinifera] 99 5e-19 ref|XP_002279090.1| PREDICTED: 40S ribosomal protein S15a-like i... 99 5e-19 >sp|Q9AT34.3|RS15A_DAUCA RecName: Full=40S ribosomal protein S15a gi|13560779|gb|AAK30203.1|AF349962_1 cytoplasmic ribosomal protein S15a [Daucus carota] Length = 130 Score = 99.8 bits (247), Expect = 2e-19 Identities = 47/47 (100%), Positives = 47/47 (100%) Frame = +1 Query: 1 KEIEPWTARLLPSRQFGYIVLTTSAGIMDHEEARRKNVGGKVLGFFY 141 KEIEPWTARLLPSRQFGYIVLTTSAGIMDHEEARRKNVGGKVLGFFY Sbjct: 84 KEIEPWTARLLPSRQFGYIVLTTSAGIMDHEEARRKNVGGKVLGFFY 130 >gb|ACF06470.1| cytoplasmic ribosomal protein S15a [Elaeis guineensis] gi|192910726|gb|ACF06471.1| cytoplasmic ribosomal protein S15a [Elaeis guineensis] Length = 130 Score = 99.8 bits (247), Expect = 2e-19 Identities = 47/47 (100%), Positives = 47/47 (100%) Frame = +1 Query: 1 KEIEPWTARLLPSRQFGYIVLTTSAGIMDHEEARRKNVGGKVLGFFY 141 KEIEPWTARLLPSRQFGYIVLTTSAGIMDHEEARRKNVGGKVLGFFY Sbjct: 84 KEIEPWTARLLPSRQFGYIVLTTSAGIMDHEEARRKNVGGKVLGFFY 130 >gb|AEO34861.1| hypothetical protein [Amblyomma maculatum] Length = 130 Score = 98.6 bits (244), Expect = 5e-19 Identities = 46/47 (97%), Positives = 47/47 (100%) Frame = +1 Query: 1 KEIEPWTARLLPSRQFGYIVLTTSAGIMDHEEARRKNVGGKVLGFFY 141 K+IEPWTARLLPSRQFGYIVLTTSAGIMDHEEARRKNVGGKVLGFFY Sbjct: 84 KDIEPWTARLLPSRQFGYIVLTTSAGIMDHEEARRKNVGGKVLGFFY 130 >emb|CBI31713.3| unnamed protein product [Vitis vinifera] Length = 175 Score = 98.6 bits (244), Expect = 5e-19 Identities = 46/47 (97%), Positives = 47/47 (100%) Frame = +1 Query: 1 KEIEPWTARLLPSRQFGYIVLTTSAGIMDHEEARRKNVGGKVLGFFY 141 K+IEPWTARLLPSRQFGYIVLTTSAGIMDHEEARRKNVGGKVLGFFY Sbjct: 129 KDIEPWTARLLPSRQFGYIVLTTSAGIMDHEEARRKNVGGKVLGFFY 175 >ref|XP_002279090.1| PREDICTED: 40S ribosomal protein S15a-like isoform 1 [Vitis vinifera] gi|225449601|ref|XP_002284061.1| PREDICTED: 40S ribosomal protein S15a-like [Vitis vinifera] gi|359481341|ref|XP_003632608.1| PREDICTED: 40S ribosomal protein S15a-like isoform 2 [Vitis vinifera] gi|147781237|emb|CAN65143.1| hypothetical protein VITISV_007037 [Vitis vinifera] gi|147790711|emb|CAN76515.1| hypothetical protein VITISV_017255 [Vitis vinifera] gi|297741553|emb|CBI32685.3| unnamed protein product [Vitis vinifera] Length = 130 Score = 98.6 bits (244), Expect = 5e-19 Identities = 46/47 (97%), Positives = 47/47 (100%) Frame = +1 Query: 1 KEIEPWTARLLPSRQFGYIVLTTSAGIMDHEEARRKNVGGKVLGFFY 141 K+IEPWTARLLPSRQFGYIVLTTSAGIMDHEEARRKNVGGKVLGFFY Sbjct: 84 KDIEPWTARLLPSRQFGYIVLTTSAGIMDHEEARRKNVGGKVLGFFY 130