BLASTX nr result
ID: Salvia21_contig00005000
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Salvia21_contig00005000 (342 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002317301.1| outward rectifying potassium channel [Populu... 82 3e-14 sp|Q69TN4.1|KCO3_ORYSJ RecName: Full=Two pore potassium channel ... 79 5e-13 ref|XP_002519734.1| Calcium-activated outward-rectifying potassi... 79 5e-13 gb|EAZ08520.1| hypothetical protein OsI_30791 [Oryza sativa Indi... 79 5e-13 ref|XP_002462155.1| hypothetical protein SORBIDRAFT_02g020740 [S... 77 1e-12 >ref|XP_002317301.1| outward rectifying potassium channel [Populus trichocarpa] gi|222860366|gb|EEE97913.1| outward rectifying potassium channel [Populus trichocarpa] Length = 428 Score = 82.4 bits (202), Expect = 3e-14 Identities = 41/51 (80%), Positives = 44/51 (86%) Frame = -2 Query: 341 KSEYVIYKLKEMGKISEHDILKICHQFERLDGGNCGKISLVDLIESRQQHP 189 KSEYVIYKLKEMGKISE DIL+IC QFERLD GNCGKI+L DL+ES HP Sbjct: 381 KSEYVIYKLKEMGKISEKDILQICQQFERLDTGNCGKITLADLMES---HP 428 >sp|Q69TN4.1|KCO3_ORYSJ RecName: Full=Two pore potassium channel c; Short=Two K(+) channel c; AltName: Full=Calcium-activated outward-rectifying potassium channel 3; Short=OsKCO3 gi|50725050|dbj|BAD33183.1| putative outward-rectifying potassium channel KCO1 [Oryza sativa Japonica Group] gi|125605102|gb|EAZ44138.1| hypothetical protein OsJ_28764 [Oryza sativa Japonica Group] Length = 456 Score = 78.6 bits (192), Expect = 5e-13 Identities = 35/48 (72%), Positives = 42/48 (87%) Frame = -2 Query: 341 KSEYVIYKLKEMGKISEHDILKICHQFERLDGGNCGKISLVDLIESRQ 198 KSE+V+YKLKEMGKISE DI+ IC QF+R+D GNCGKI+L DL+ES Q Sbjct: 395 KSEFVVYKLKEMGKISEKDIMMICDQFQRMDSGNCGKITLSDLLESHQ 442 >ref|XP_002519734.1| Calcium-activated outward-rectifying potassium channel, putative [Ricinus communis] gi|223541151|gb|EEF42707.1| Calcium-activated outward-rectifying potassium channel, putative [Ricinus communis] Length = 426 Score = 78.6 bits (192), Expect = 5e-13 Identities = 34/48 (70%), Positives = 42/48 (87%) Frame = -2 Query: 341 KSEYVIYKLKEMGKISEHDILKICHQFERLDGGNCGKISLVDLIESRQ 198 KSEYVIYKLKEMGK+SE D+L+IC F+R+D GNCGKI+L DL+E+ Q Sbjct: 379 KSEYVIYKLKEMGKVSEKDVLQICQTFDRIDAGNCGKITLADLMETHQ 426 >gb|EAZ08520.1| hypothetical protein OsI_30791 [Oryza sativa Indica Group] Length = 453 Score = 78.6 bits (192), Expect = 5e-13 Identities = 35/48 (72%), Positives = 42/48 (87%) Frame = -2 Query: 341 KSEYVIYKLKEMGKISEHDILKICHQFERLDGGNCGKISLVDLIESRQ 198 KSE+V+YKLKEMGKISE DI+ IC QF+R+D GNCGKI+L DL+ES Q Sbjct: 392 KSEFVVYKLKEMGKISEKDIMMICDQFQRMDSGNCGKITLSDLLESHQ 439 >ref|XP_002462155.1| hypothetical protein SORBIDRAFT_02g020740 [Sorghum bicolor] gi|241925532|gb|EER98676.1| hypothetical protein SORBIDRAFT_02g020740 [Sorghum bicolor] Length = 468 Score = 77.0 bits (188), Expect = 1e-12 Identities = 36/46 (78%), Positives = 41/46 (89%) Frame = -2 Query: 341 KSEYVIYKLKEMGKISEHDILKICHQFERLDGGNCGKISLVDLIES 204 KSE+VIYKLKEMGKISE DI+ IC QF+RLD GNCGKI+L DL+ES Sbjct: 407 KSEFVIYKLKEMGKISEKDIMMICDQFQRLDTGNCGKITLSDLLES 452