BLASTX nr result
ID: Salvia21_contig00004952
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Salvia21_contig00004952 (389 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002513626.1| conserved hypothetical protein [Ricinus comm... 67 1e-09 >ref|XP_002513626.1| conserved hypothetical protein [Ricinus communis] gi|223547534|gb|EEF49029.1| conserved hypothetical protein [Ricinus communis] Length = 217 Score = 67.4 bits (163), Expect = 1e-09 Identities = 35/75 (46%), Positives = 48/75 (64%), Gaps = 3/75 (4%) Frame = -2 Query: 220 MAEKQQSAYP--ANGYIRSGDTEAAAAH-NVREQRKKKRTKCILYILLFIVFQTAIITVF 50 MAEK+Q+ P A+G RS + A +E RKKKR KCI +++ F +FQT II +F Sbjct: 1 MAEKEQAPTPLVADGQTRSDEESGTAGTAQTKELRKKKRMKCIAFVVAFTIFQTGIILLF 60 Query: 49 ALTVMKVKTPKFRIR 5 TV++ K PKFR+R Sbjct: 61 VFTVLRFKDPKFRVR 75