BLASTX nr result
ID: Salvia21_contig00004321
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Salvia21_contig00004321 (294 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_186922.1| thioredoxin F1 [Arabidopsis thaliana] gi|277352... 144 1e-32 ref|XP_002325907.1| thioredoxin f [Populus trichocarpa] gi|11848... 144 1e-32 gb|ADQ53451.1| plastid thioredoxin F precursor [Nicotiana tabacum] 142 2e-32 ref|XP_002884335.1| thioredoxin F-type 1 [Arabidopsis lyrata sub... 142 3e-32 gb|AAD35003.1|AF144385_1 thioredoxin f1 [Arabidopsis thaliana] 142 4e-32 >ref|NP_186922.1| thioredoxin F1 [Arabidopsis thaliana] gi|27735269|sp|Q9XFH8.2|TRXF1_ARATH RecName: Full=Thioredoxin F1, chloroplastic; Short=AtTrxf1; AltName: Full=Thioredoxin F2; Short=AtTrxf2; Flags: Precursor gi|6728989|gb|AAF26987.1|AC018363_32 thioredoxin f1 [Arabidopsis thaliana] gi|17529210|gb|AAL38832.1| putative thioredoxin f1 protein [Arabidopsis thaliana] gi|20466041|gb|AAM20355.1| putative thioredoxin f1 protein [Arabidopsis thaliana] gi|21537004|gb|AAM61345.1| thioredoxin f1 [Arabidopsis thaliana] gi|332640331|gb|AEE73852.1| thioredoxin F1 [Arabidopsis thaliana] Length = 178 Score = 144 bits (362), Expect = 1e-32 Identities = 66/77 (85%), Positives = 73/77 (94%) Frame = -3 Query: 292 MYTQWCGPCKVIAPKYQQLSEKYDDVVFLKLDCNDENRPLAKELGIKVVPTFKILKDNKI 113 MYTQWCGPCKVIAPKY+ LSEKYDDVVFLKLDCN +NRPLAKELGI+VVPTFKILKDNK+ Sbjct: 94 MYTQWCGPCKVIAPKYKALSEKYDDVVFLKLDCNPDNRPLAKELGIRVVPTFKILKDNKV 153 Query: 112 VKEVTGAKIDNLILAID 62 VKEVTGAK D+L+ AI+ Sbjct: 154 VKEVTGAKYDDLVAAIE 170 >ref|XP_002325907.1| thioredoxin f [Populus trichocarpa] gi|118488397|gb|ABK96015.1| unknown [Populus trichocarpa] gi|222862782|gb|EEF00289.1| thioredoxin f [Populus trichocarpa] Length = 188 Score = 144 bits (362), Expect = 1e-32 Identities = 65/78 (83%), Positives = 74/78 (94%) Frame = -3 Query: 292 MYTQWCGPCKVIAPKYQQLSEKYDDVVFLKLDCNDENRPLAKELGIKVVPTFKILKDNKI 113 MYTQWCGPCK+IAPKY++LS+KYDDVVFLKLDCN EN+PLAKELGIKVVPTFKILK KI Sbjct: 106 MYTQWCGPCKLIAPKYKELSQKYDDVVFLKLDCNQENKPLAKELGIKVVPTFKILKQGKI 165 Query: 112 VKEVTGAKIDNLILAIDA 59 VKEVTGAK DNL++AI++ Sbjct: 166 VKEVTGAKFDNLVIAIES 183 >gb|ADQ53451.1| plastid thioredoxin F precursor [Nicotiana tabacum] Length = 175 Score = 142 bits (359), Expect = 2e-32 Identities = 65/77 (84%), Positives = 74/77 (96%) Frame = -3 Query: 292 MYTQWCGPCKVIAPKYQQLSEKYDDVVFLKLDCNDENRPLAKELGIKVVPTFKILKDNKI 113 MYTQWCGPCKVIAPK+Q+LS+ Y+DVVFLKLDCN +NRPLAKELGIKVVPTFKILK+NK+ Sbjct: 94 MYTQWCGPCKVIAPKFQELSKNYNDVVFLKLDCNQDNRPLAKELGIKVVPTFKILKNNKV 153 Query: 112 VKEVTGAKIDNLILAID 62 VKEVTGAK+DNLI AI+ Sbjct: 154 VKEVTGAKLDNLIAAIE 170 >ref|XP_002884335.1| thioredoxin F-type 1 [Arabidopsis lyrata subsp. lyrata] gi|297330175|gb|EFH60594.1| thioredoxin F-type 1 [Arabidopsis lyrata subsp. lyrata] Length = 178 Score = 142 bits (358), Expect = 3e-32 Identities = 65/77 (84%), Positives = 73/77 (94%) Frame = -3 Query: 292 MYTQWCGPCKVIAPKYQQLSEKYDDVVFLKLDCNDENRPLAKELGIKVVPTFKILKDNKI 113 MYTQWCGPCKVIAPKY+ LSEKY+DVVFLKLDCN +NRPLAKELGI+VVPTFKILKDNK+ Sbjct: 94 MYTQWCGPCKVIAPKYKALSEKYEDVVFLKLDCNPDNRPLAKELGIRVVPTFKILKDNKV 153 Query: 112 VKEVTGAKIDNLILAID 62 VKEVTGAK D+L+ AI+ Sbjct: 154 VKEVTGAKYDDLVAAIE 170 >gb|AAD35003.1|AF144385_1 thioredoxin f1 [Arabidopsis thaliana] Length = 178 Score = 142 bits (357), Expect = 4e-32 Identities = 65/77 (84%), Positives = 72/77 (93%) Frame = -3 Query: 292 MYTQWCGPCKVIAPKYQQLSEKYDDVVFLKLDCNDENRPLAKELGIKVVPTFKILKDNKI 113 MYTQWCGPCKVIAPKY+ LSEKYDDVVFLKLDCN +NRPL KELGI+VVPTFKILKDNK+ Sbjct: 94 MYTQWCGPCKVIAPKYKALSEKYDDVVFLKLDCNPDNRPLPKELGIRVVPTFKILKDNKV 153 Query: 112 VKEVTGAKIDNLILAID 62 VKEVTGAK D+L+ AI+ Sbjct: 154 VKEVTGAKYDDLVAAIE 170