BLASTX nr result
ID: Salvia21_contig00003552
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Salvia21_contig00003552 (486 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004145537.1| PREDICTED: dolichol-phosphate mannosyltransf... 55 6e-06 ref|XP_002300644.1| predicted protein [Populus trichocarpa] gi|2... 55 8e-06 ref|XP_002285933.1| PREDICTED: dolichol-phosphate mannosyltransf... 55 8e-06 >ref|XP_004145537.1| PREDICTED: dolichol-phosphate mannosyltransferase-like [Cucumis sativus] gi|449512678|ref|XP_004164113.1| PREDICTED: dolichol-phosphate mannosyltransferase-like [Cucumis sativus] Length = 242 Score = 55.1 bits (131), Expect = 6e-06 Identities = 25/34 (73%), Positives = 30/34 (88%) Frame = -1 Query: 102 EAKAEGNKYSIIVPTFNERQNIALIVYLIFKHLP 1 E + E +KYS+IVPT+NER NIAL+VYLIFKHLP Sbjct: 3 EPEKERDKYSLIVPTYNERINIALLVYLIFKHLP 36 >ref|XP_002300644.1| predicted protein [Populus trichocarpa] gi|222842370|gb|EEE79917.1| predicted protein [Populus trichocarpa] Length = 240 Score = 54.7 bits (130), Expect = 8e-06 Identities = 26/31 (83%), Positives = 28/31 (90%) Frame = -1 Query: 96 KAEGNKYSIIVPTFNERQNIALIVYLIFKHL 4 K + NKYSIIVPT+NER NIALIVYLIFKHL Sbjct: 3 KEKKNKYSIIVPTYNERLNIALIVYLIFKHL 33 >ref|XP_002285933.1| PREDICTED: dolichol-phosphate mannosyltransferase [Vitis vinifera] gi|302141662|emb|CBI18865.3| unnamed protein product [Vitis vinifera] Length = 243 Score = 54.7 bits (130), Expect = 8e-06 Identities = 26/31 (83%), Positives = 28/31 (90%) Frame = -1 Query: 96 KAEGNKYSIIVPTFNERQNIALIVYLIFKHL 4 K GNKYSIIVPT+NER NIALIV+LIFKHL Sbjct: 6 KNGGNKYSIIVPTYNERLNIALIVFLIFKHL 36