BLASTX nr result
ID: Salvia21_contig00002975
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Salvia21_contig00002975 (432 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAW56945.1| putative SAMDC uORF [Phaseolus vulgaris] 64 1e-08 ref|XP_003631339.1| PREDICTED: S-adenosylmethionine decarboxylas... 64 1e-08 gb|AAB03864.1| putative ORF; conserved in 5' leaders of plant SA... 64 1e-08 gb|AAC48988.1| putative [Catharanthus roseus] 64 2e-08 ref|XP_003516785.1| PREDICTED: S-adenosylmethionine decarboxylas... 64 2e-08 >gb|AAW56945.1| putative SAMDC uORF [Phaseolus vulgaris] Length = 53 Score = 63.9 bits (154), Expect = 1e-08 Identities = 29/37 (78%), Positives = 32/37 (86%) Frame = +2 Query: 260 NLYSTKPLGYNIEDIRPNGGIKKFRSTAYSNCACKPS 370 +L+ PLGY+IEDIRPNGGIKKFRS AYSNCA KPS Sbjct: 17 SLFYEAPLGYSIEDIRPNGGIKKFRSAAYSNCARKPS 53 >ref|XP_003631339.1| PREDICTED: S-adenosylmethionine decarboxylase proenzyme [Vitis vinifera] Length = 410 Score = 63.9 bits (154), Expect = 1e-08 Identities = 29/37 (78%), Positives = 32/37 (86%) Frame = +2 Query: 260 NLYSTKPLGYNIEDIRPNGGIKKFRSTAYSNCACKPS 370 +L+ PLGY+IEDIRPNGGIKKFRS AYSNCA KPS Sbjct: 14 SLFYEAPLGYSIEDIRPNGGIKKFRSAAYSNCARKPS 50 >gb|AAB03864.1| putative ORF; conserved in 5' leaders of plant SAMdC [Pisum sativum] Length = 54 Score = 63.9 bits (154), Expect = 1e-08 Identities = 29/37 (78%), Positives = 32/37 (86%) Frame = +2 Query: 260 NLYSTKPLGYNIEDIRPNGGIKKFRSTAYSNCACKPS 370 +L+ PLGY+IEDIRPNGGIKKFRS AYSNCA KPS Sbjct: 18 SLFYEAPLGYSIEDIRPNGGIKKFRSAAYSNCARKPS 54 >gb|AAC48988.1| putative [Catharanthus roseus] Length = 51 Score = 63.5 bits (153), Expect = 2e-08 Identities = 28/37 (75%), Positives = 32/37 (86%) Frame = +2 Query: 260 NLYSTKPLGYNIEDIRPNGGIKKFRSTAYSNCACKPS 370 +L+ PLGY+IED+RPNGGIKKFRS AYSNCA KPS Sbjct: 15 SLFYEAPLGYSIEDVRPNGGIKKFRSAAYSNCARKPS 51 >ref|XP_003516785.1| PREDICTED: S-adenosylmethionine decarboxylase proenzyme-like [Glycine max] Length = 408 Score = 63.5 bits (153), Expect = 2e-08 Identities = 28/37 (75%), Positives = 32/37 (86%) Frame = +2 Query: 260 NLYSTKPLGYNIEDIRPNGGIKKFRSTAYSNCACKPS 370 +L+ PLGY+IED+RPNGGIKKFRS AYSNCA KPS Sbjct: 17 SLFYEAPLGYSIEDVRPNGGIKKFRSAAYSNCARKPS 53