BLASTX nr result
ID: Salvia21_contig00002936
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Salvia21_contig00002936 (771 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003630198.1| Protein IDA-like protein [Medicago truncatul... 67 3e-09 ref|XP_003602561.1| Protein IDA-like protein [Medicago truncatul... 66 1e-08 ref|XP_002533404.1| conserved hypothetical protein [Ricinus comm... 65 1e-08 gb|AFK45340.1| unknown [Medicago truncatula] 64 3e-08 ref|XP_002328327.1| predicted protein [Populus trichocarpa] gi|2... 60 7e-07 >ref|XP_003630198.1| Protein IDA-like protein [Medicago truncatula] gi|357519903|ref|XP_003630240.1| Protein IDA-like protein [Medicago truncatula] gi|355524220|gb|AET04674.1| Protein IDA-like protein [Medicago truncatula] gi|355524262|gb|AET04716.1| Protein IDA-like protein [Medicago truncatula] Length = 76 Score = 67.4 bits (163), Expect = 3e-09 Identities = 31/55 (56%), Positives = 40/55 (72%), Gaps = 1/55 (1%) Frame = +1 Query: 280 GHCNASRSINAFKVRPRQQNSTDHFLNFMPKRW-IPASAPSRKHNDLGLQSWRFP 441 G C+ SR+ N FKV+P+ ++ HF F+PKR IP S PSRKHND+GL+SWR P Sbjct: 23 GQCHGSRTTNDFKVKPKSEHQ-GHFFGFLPKRMHIPYSTPSRKHNDIGLRSWRSP 76 >ref|XP_003602561.1| Protein IDA-like protein [Medicago truncatula] gi|355491609|gb|AES72812.1| Protein IDA-like protein [Medicago truncatula] Length = 76 Score = 65.9 bits (159), Expect = 1e-08 Identities = 31/55 (56%), Positives = 41/55 (74%), Gaps = 1/55 (1%) Frame = +1 Query: 280 GHCNASRSINAFKVRPRQQNSTDHFLNFMPKRW-IPASAPSRKHNDLGLQSWRFP 441 GHC+ SR+ N FKV+P+ ++ HF F+P+R IP S+PSRKHND+GLQS R P Sbjct: 23 GHCDGSRATNVFKVKPKYEHK-GHFFGFLPRRIPIPYSSPSRKHNDIGLQSLRSP 76 >ref|XP_002533404.1| conserved hypothetical protein [Ricinus communis] gi|223526749|gb|EEF28977.1| conserved hypothetical protein [Ricinus communis] Length = 87 Score = 65.5 bits (158), Expect = 1e-08 Identities = 31/56 (55%), Positives = 42/56 (75%), Gaps = 2/56 (3%) Frame = +1 Query: 280 GHCNASRSI-NAFKVRPRQQNSTDHFLNFMPKRW-IPASAPSRKHNDLGLQSWRFP 441 G+C+ SR+ N F V+P+ Q+ HFLNF+P+ + IP S PSR+HND+GLQSWR P Sbjct: 33 GYCHGSRTTANVFDVKPKNQHR-GHFLNFLPRHFPIPTSGPSRRHNDIGLQSWRSP 87 >gb|AFK45340.1| unknown [Medicago truncatula] Length = 76 Score = 64.3 bits (155), Expect = 3e-08 Identities = 31/55 (56%), Positives = 40/55 (72%), Gaps = 1/55 (1%) Frame = +1 Query: 280 GHCNASRSINAFKVRPRQQNSTDHFLNFMPKRW-IPASAPSRKHNDLGLQSWRFP 441 GHC+ SR+ N FKV+P+ ++ HF F+P R IP S+PSRKHND+GLQS R P Sbjct: 23 GHCDGSRATNVFKVKPKYEHK-GHFFGFLPGRIPIPYSSPSRKHNDIGLQSLRSP 76 >ref|XP_002328327.1| predicted protein [Populus trichocarpa] gi|222838042|gb|EEE76407.1| predicted protein [Populus trichocarpa] Length = 78 Score = 59.7 bits (143), Expect = 7e-07 Identities = 28/55 (50%), Positives = 37/55 (67%), Gaps = 1/55 (1%) Frame = +1 Query: 280 GHCNASRSINAFKVRPRQQNSTDHFLNFMPKRW-IPASAPSRKHNDLGLQSWRFP 441 G+ + SRS N F +P+ Q HFLNF+P+ IP S PSR+HN +GLQ+WR P Sbjct: 25 GYSHGSRSTNVFNFKPKTQYK-GHFLNFLPRHLPIPTSGPSRRHNGIGLQNWRSP 78