BLASTX nr result
ID: Salvia21_contig00001673
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Salvia21_contig00001673 (613 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AFW85971.1| hypothetical protein ZEAMMB73_815951 [Zea mays] 60 3e-07 ref|NP_001183712.1| uncharacterized protein LOC100502305 [Zea ma... 60 3e-07 ref|XP_002437774.1| hypothetical protein SORBIDRAFT_10g002370 [S... 59 7e-07 ref|XP_002437777.1| hypothetical protein SORBIDRAFT_10g002400 [S... 58 2e-06 ref|XP_002304437.1| predicted protein [Populus trichocarpa] gi|2... 57 2e-06 >gb|AFW85971.1| hypothetical protein ZEAMMB73_815951 [Zea mays] Length = 307 Score = 60.1 bits (144), Expect = 3e-07 Identities = 28/46 (60%), Positives = 32/46 (69%) Frame = -3 Query: 611 LGSDGKVATVQTLQNLNEDELDGFEQAWGGIADSHLHSWNNTSDFP 474 L SDGKV T QTL NLNEDEL GFEQ+W G A +L WN+ + P Sbjct: 216 LNSDGKVDTTQTLHNLNEDELAGFEQSWKGNAGHYLPDWNHNAGAP 261 >ref|NP_001183712.1| uncharacterized protein LOC100502305 [Zea mays] gi|238014094|gb|ACR38082.1| unknown [Zea mays] gi|413953321|gb|AFW85970.1| hypothetical protein ZEAMMB73_815951 [Zea mays] Length = 309 Score = 60.1 bits (144), Expect = 3e-07 Identities = 28/46 (60%), Positives = 32/46 (69%) Frame = -3 Query: 611 LGSDGKVATVQTLQNLNEDELDGFEQAWGGIADSHLHSWNNTSDFP 474 L SDGKV T QTL NLNEDEL GFEQ+W G A +L WN+ + P Sbjct: 218 LNSDGKVDTTQTLHNLNEDELAGFEQSWKGNAGHYLPDWNHNAGAP 263 >ref|XP_002437774.1| hypothetical protein SORBIDRAFT_10g002370 [Sorghum bicolor] gi|241915997|gb|EER89141.1| hypothetical protein SORBIDRAFT_10g002370 [Sorghum bicolor] Length = 321 Score = 58.9 bits (141), Expect = 7e-07 Identities = 27/46 (58%), Positives = 31/46 (67%) Frame = -3 Query: 611 LGSDGKVATVQTLQNLNEDELDGFEQAWGGIADSHLHSWNNTSDFP 474 L SDGKV T QTL NLNEDEL GFE++W G A +L WN + P Sbjct: 230 LNSDGKVDTTQTLHNLNEDELAGFEESWKGNAGHYLPGWNQNAGVP 275 >ref|XP_002437777.1| hypothetical protein SORBIDRAFT_10g002400 [Sorghum bicolor] gi|241916000|gb|EER89144.1| hypothetical protein SORBIDRAFT_10g002400 [Sorghum bicolor] Length = 323 Score = 57.8 bits (138), Expect = 2e-06 Identities = 26/46 (56%), Positives = 31/46 (67%) Frame = -3 Query: 611 LGSDGKVATVQTLQNLNEDELDGFEQAWGGIADSHLHSWNNTSDFP 474 L SDGKV T QT+ NLNEDEL GFE++W G A +L WN + P Sbjct: 232 LNSDGKVDTTQTMHNLNEDELAGFEESWKGNAGHYLPGWNQNAGAP 277 >ref|XP_002304437.1| predicted protein [Populus trichocarpa] gi|222841869|gb|EEE79416.1| predicted protein [Populus trichocarpa] Length = 266 Score = 57.4 bits (137), Expect = 2e-06 Identities = 26/39 (66%), Positives = 29/39 (74%) Frame = -3 Query: 611 LGSDGKVATVQTLQNLNEDELDGFEQAWGGIADSHLHSW 495 L SDG+V T+QTL NLNEDEL GFE+AW G A HL W Sbjct: 228 LKSDGRVDTMQTLHNLNEDELSGFEEAWKGNAGKHLPGW 266