BLASTX nr result
ID: Salvia21_contig00001307
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Salvia21_contig00001307 (1007 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002532208.1| conserved hypothetical protein [Ricinus comm... 68 4e-09 emb|CBI15013.3| unnamed protein product [Vitis vinifera] 66 2e-08 ref|XP_002282383.1| PREDICTED: uncharacterized protein LOC100267... 66 2e-08 emb|CAN75322.1| hypothetical protein VITISV_003764 [Vitis vinifera] 66 2e-08 ref|XP_004152556.1| PREDICTED: F-box protein SKIP16-like [Cucumi... 65 2e-08 >ref|XP_002532208.1| conserved hypothetical protein [Ricinus communis] gi|223528104|gb|EEF30177.1| conserved hypothetical protein [Ricinus communis] Length = 368 Score = 67.8 bits (164), Expect = 4e-09 Identities = 30/56 (53%), Positives = 41/56 (73%) Frame = -1 Query: 437 ENFRTEAQVEKLVGRFRPVSQQLQDKKCLKLSIGTTVCAAHGTSDNDLRFYDAVVE 270 +NF+ ++E RFRP+S QLQDK+C KLS+GT VCA+H ++ D RFYD VV+ Sbjct: 60 QNFKCAEEIEIFEKRFRPLSNQLQDKECKKLSVGTVVCASHSFTNLDNRFYDGVVD 115 >emb|CBI15013.3| unnamed protein product [Vitis vinifera] Length = 375 Score = 65.9 bits (159), Expect = 2e-08 Identities = 30/39 (76%), Positives = 36/39 (92%) Frame = -2 Query: 187 DYKEAARLRDSLELFDEEEPALRLQRLLKEAISQERFEE 71 DYKEAARLRDSL LF+EEEP LRL+RL+KEA++ ERFE+ Sbjct: 183 DYKEAARLRDSLRLFEEEEPVLRLRRLIKEAVADERFED 221 >ref|XP_002282383.1| PREDICTED: uncharacterized protein LOC100267315 [Vitis vinifera] Length = 277 Score = 65.9 bits (159), Expect = 2e-08 Identities = 30/39 (76%), Positives = 36/39 (92%) Frame = -2 Query: 187 DYKEAARLRDSLELFDEEEPALRLQRLLKEAISQERFEE 71 DYKEAARLRDSL LF+EEEP LRL+RL+KEA++ ERFE+ Sbjct: 85 DYKEAARLRDSLRLFEEEEPVLRLRRLIKEAVADERFED 123 >emb|CAN75322.1| hypothetical protein VITISV_003764 [Vitis vinifera] Length = 223 Score = 65.9 bits (159), Expect = 2e-08 Identities = 30/39 (76%), Positives = 36/39 (92%) Frame = -2 Query: 187 DYKEAARLRDSLELFDEEEPALRLQRLLKEAISQERFEE 71 DYKEAARLRDSL LF+EEEP LRL+RL+KEA++ ERFE+ Sbjct: 31 DYKEAARLRDSLRLFEEEEPVLRLRRLIKEAVADERFED 69 >ref|XP_004152556.1| PREDICTED: F-box protein SKIP16-like [Cucumis sativus] gi|449487861|ref|XP_004157837.1| PREDICTED: F-box protein SKIP16-like [Cucumis sativus] Length = 261 Score = 65.5 bits (158), Expect = 2e-08 Identities = 30/39 (76%), Positives = 37/39 (94%) Frame = -2 Query: 187 DYKEAARLRDSLELFDEEEPALRLQRLLKEAISQERFEE 71 DY+EAAR+RDSL+LF+EEEP LRL+RL+KEAIS ERFE+ Sbjct: 71 DYEEAARIRDSLKLFEEEEPVLRLRRLMKEAISSERFED 109