BLASTX nr result
ID: Salvia21_contig00000910
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Salvia21_contig00000910 (560 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAH59409.1| hypothetical protein [Plantago major] 59 4e-07 gb|ADK13061.1| conserved hypothetical protein 4 [Hevea brasilien... 59 4e-07 ref|NP_563969.1| translation machinery associated protein TMA7 [... 59 5e-07 gb|ADK13065.1| conserved hypothetical protein 8 [Hevea brasilien... 58 1e-06 ref|XP_002516062.1| Coiled-coil domain-containing protein, putat... 57 2e-06 >emb|CAH59409.1| hypothetical protein [Plantago major] Length = 63 Score = 59.3 bits (142), Expect = 4e-07 Identities = 27/30 (90%), Positives = 29/30 (96%) Frame = +3 Query: 90 MSTKQGGKAKPLKQPKAEKKEYDETDKANI 179 MS+KQGGKAKPLKQPK+EKKEYDE DKANI Sbjct: 1 MSSKQGGKAKPLKQPKSEKKEYDEIDKANI 30 >gb|ADK13061.1| conserved hypothetical protein 4 [Hevea brasiliensis] Length = 64 Score = 59.3 bits (142), Expect = 4e-07 Identities = 27/30 (90%), Positives = 29/30 (96%) Frame = +3 Query: 90 MSTKQGGKAKPLKQPKAEKKEYDETDKANI 179 MS+KQGGKAKPLKQPKAEKK+YDETD ANI Sbjct: 1 MSSKQGGKAKPLKQPKAEKKDYDETDTANI 30 >ref|NP_563969.1| translation machinery associated protein TMA7 [Arabidopsis thaliana] gi|297849952|ref|XP_002892857.1| hypothetical protein ARALYDRAFT_471721 [Arabidopsis lyrata subsp. lyrata] gi|5103825|gb|AAD39655.1|AC007591_20 ESTs gb|AA650895, gb|AA720043 and gb|R29777 come from this gene [Arabidopsis thaliana] gi|12484215|gb|AAG54006.1|AF336925_1 unknown protein [Arabidopsis thaliana] gi|15028107|gb|AAK76677.1| unknown protein [Arabidopsis thaliana] gi|17065256|gb|AAL32782.1| Unknown protein [Arabidopsis thaliana] gi|20260078|gb|AAM13386.1| unknown protein [Arabidopsis thaliana] gi|21592316|gb|AAM64267.1| unknown [Arabidopsis thaliana] gi|297338699|gb|EFH69116.1| hypothetical protein ARALYDRAFT_471721 [Arabidopsis lyrata subsp. lyrata] gi|332191176|gb|AEE29297.1| translation machinery associated protein TMA7 [Arabidopsis thaliana] Length = 64 Score = 58.9 bits (141), Expect = 5e-07 Identities = 27/30 (90%), Positives = 29/30 (96%) Frame = +3 Query: 90 MSTKQGGKAKPLKQPKAEKKEYDETDKANI 179 MS+KQGGKAKPLKQPKA+KKEYDETD ANI Sbjct: 1 MSSKQGGKAKPLKQPKADKKEYDETDLANI 30 >gb|ADK13065.1| conserved hypothetical protein 8 [Hevea brasiliensis] Length = 64 Score = 57.8 bits (138), Expect = 1e-06 Identities = 26/30 (86%), Positives = 29/30 (96%) Frame = +3 Query: 90 MSTKQGGKAKPLKQPKAEKKEYDETDKANI 179 MS+KQGGKAKPL+QPKAEKK+YDETD ANI Sbjct: 1 MSSKQGGKAKPLEQPKAEKKDYDETDTANI 30 >ref|XP_002516062.1| Coiled-coil domain-containing protein, putative [Ricinus communis] gi|223544967|gb|EEF46482.1| Coiled-coil domain-containing protein, putative [Ricinus communis] Length = 64 Score = 57.4 bits (137), Expect = 2e-06 Identities = 27/30 (90%), Positives = 28/30 (93%) Frame = +3 Query: 90 MSTKQGGKAKPLKQPKAEKKEYDETDKANI 179 MS+KQGGKAKPLKQPKA KKEYDETD ANI Sbjct: 1 MSSKQGGKAKPLKQPKAGKKEYDETDLANI 30